Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_012334422.1 M446_RS22560 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_000019365.1:WP_012334422.1 Length = 288 Score = 127 bits (318), Expect = 4e-34 Identities = 75/203 (36%), Positives = 110/203 (54%), Gaps = 10/203 (4%) Query: 92 ANPQDKPPVACLFFKASQALAGPGDDIVLPRLARDEKNDYEVELCVVLGKDAKDVDEKDA 151 A P D P V F + + +L G+ ++ PR + +K DYE EL V+G+ A+ V +A Sbjct: 96 AEPLDYPDV---FMRGANSLVAHGEPLIRPRCS--DKFDYEGELVFVVGRKARHVGLDEA 150 Query: 152 MSFVGGYCVVNDVSSRGLCAKGGQWGMGKSYDTWCPFGPCLVSPSALGADPHKLTITTHV 211 + GY V N+ S R + QW MGK++D FGP LV+P L L +TT + Sbjct: 151 CGIIAGYSVFNEGSIRDYQRRATQWTMGKNFDGTGGFGPDLVTPDELPDGADGLRLTTTL 210 Query: 212 NGKLAQKGNTADLVLKIPELIARLSHGTTLQAGSLILTGSPIALGRKAPGDAVEQSPFMK 271 NG + Q GNT D + + ++A L+ TL+ G ++LTG+P +G A F+K Sbjct: 211 NGHVMQDGNTHDFIFPVARIVAILTEAMTLEPGDVVLTGTPSGVGY-----ARNPPVFIK 265 Query: 272 DGDEIRCFVEGCGTLINSVRDEA 294 GD + +E GTL N+VRDEA Sbjct: 266 PGDVVEVTIEKVGTLRNTVRDEA 288 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 288 Length adjustment: 26 Effective length of query: 282 Effective length of database: 262 Effective search space: 73884 Effective search space used: 73884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory