Align L-2-keto-3-deoxyrhamnonate 4-dehydrogenase subunit (EC 1.1.1.401) (characterized)
to candidate WP_012334422.1 M446_RS22560 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase
Query= metacyc::MONOMER-16233 (285 letters) >NCBI__GCF_000019365.1:WP_012334422.1 Length = 288 Score = 163 bits (413), Expect = 4e-45 Identities = 106/263 (40%), Positives = 148/263 (56%), Gaps = 7/263 (2%) Query: 14 PGIIDADGKIRDLSGVVPELTIEALAAAKGADVASLPLVEGEPRYGVPVKGIGKIVAIGL 73 PG+ D G L PE A AA GA + L EG RY ++ GKI+ IG Sbjct: 30 PGLPDGVG---GLVAGGPEFMDRAKKAA-GAATGAARLDEGSLRYRPLIERPGKIICIGR 85 Query: 74 NYEDHAIESNLPIPTEPMMFMKALSSLNGPNDEVVLPKNSTHGDWEVELGVVIGETCRFV 133 NY HA E P +FM+ +SL + ++ P+ S D+E EL V+G R V Sbjct: 86 NYAAHAREGGAEPLDYPDVFMRGANSLVAHGEPLIRPRCSDKFDYEGELVFVVGRKARHV 145 Query: 134 SEDEALSKVAGYVLVNDVSERFNQKQRGTQWSKGKGHDTFCPVGPWLVTPDEVGDPQD-L 192 DEA +AGY + N+ S R + ++R TQW+ GK D GP LVTPDE+ D D L Sbjct: 146 GLDEACGIIAGYSVFNEGSIR-DYQRRATQWTMGKNFDGTGGFGPDLVTPDELPDGADGL 204 Query: 193 DMHLNVNGTRMQTGNTKTMIFNVAQLISYVSEYITLYPGDLMITGTPPGVGEGKKPQAIY 252 + +NG MQ GNT IF VA++++ ++E +TL PGD+++TGTP GVG + P ++ Sbjct: 205 RLTTTLNGHVMQDGNTHDFIFPVARIVAILTEAMTLEPGDVVLTGTPSGVGYARNP-PVF 263 Query: 253 LKAGDVMELGIEKLGTQRQQVSE 275 +K GDV+E+ IEK+GT R V + Sbjct: 264 IKPGDVVEVTIEKVGTLRNTVRD 286 Lambda K H 0.316 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 288 Length adjustment: 26 Effective length of query: 259 Effective length of database: 262 Effective search space: 67858 Effective search space used: 67858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory