Align Probable maleylacetoacetate isomerase 1; MAAI 1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 (characterized)
to candidate WP_012334772.1 M446_RS24335 glutathione S-transferase family protein
Query= SwissProt::Q9VHD3 (246 letters) >NCBI__GCF_000019365.1:WP_012334772.1 Length = 207 Score = 52.8 bits (125), Expect = 5e-12 Identities = 53/171 (30%), Positives = 81/171 (47%), Gaps = 27/171 (15%) Query: 47 RVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDSVAIIH 106 +V V L K +D++ P H E+R +P+ K+P+L + DS AI+H Sbjct: 14 KVLVGLFEKGLDFEHVPLRF------HDPDTEFRASSPLGKIPALCDGDFRIADSSAILH 67 Query: 107 YLEETRPQPALLPQDPVKRAKIREI-------VELICSGIQPLQNVSVLDHIGK---DQS 156 YL+ P PALLP +P RA+ R + EL+ ++P + + + K D++ Sbjct: 68 YLDAAYPGPALLPAEP--RARGRAVWFDKFADTELMGPLLRPFVHRVLRPKVLKLPGDEA 125 Query: 157 LQWAQHWIS----RGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNAR 203 + A+ I R F LE +S G F VGD S+ADI + N R Sbjct: 126 V--ARRAIDEEQPRLFGYLETQIS---GPFLVGDAFSLADIAVATGFVNLR 171 Lambda K H 0.320 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 207 Length adjustment: 22 Effective length of query: 224 Effective length of database: 185 Effective search space: 41440 Effective search space used: 41440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory