Align 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate WP_012383166.1 BIND_RS00765 acetylornithine transaminase
Query= BRENDA::Q0K2K2 (423 letters) >NCBI__GCF_000019845.1:WP_012383166.1 Length = 405 Score = 204 bits (520), Expect = 3e-57 Identities = 139/404 (34%), Positives = 203/404 (50%), Gaps = 44/404 (10%) Query: 29 DRAENATLWDVEGRAYTDFAAGIAVLNTGHRHPRVMQAIAAQLERFTHTA--YQIVPYQG 86 +R E A L G + DF GIAV + G+ HP +++A+ Q ++ HT+ +QI + Sbjct: 17 ERGEGAWLTSTTGERFLDFGGGIAVASLGYSHPHLIKALHEQGDKLWHTSNLFQIPQAE- 75 Query: 87 YVTLAERINALVPIQGLNKTALFT-TGAEAVENAIKIAR------AHTGRPGVIAFSGAF 139 LAER+ A+ FT +GAEA+E IK AR H + +I F GAF Sbjct: 76 --RLAERLTAV----SFADFVFFTNSGAEAMEGVIKTARKYHAACGHPEKNRIITFQGAF 129 Query: 140 HGRTLLGMALTGKVAPYKIGFGPFPSDIYHAPFPSALHGVSTERALQALEGLFKTDIDPA 199 HGRTL +A G Y GF P + PF L+A++ K + Sbjct: 130 HGRTLATIAAAGN-EKYLDGFEPRLPGFDNVPFGD----------LEAVKAAIKPE---- 174 Query: 200 RVAAIIVEPVQGEGGFQAAPADFMRGLRAVCDQHGIVLIADEVQTGFGRTGKMFAMSHHD 259 AI++EP+QGEGG + DF++ LR +CD+ G++L+ DEVQ+G GR+GK+FA Sbjct: 175 -TGAILIEPIQGEGGIRVVSPDFLQALRKLCDEQGLLLLLDEVQSGVGRSGKLFAYEWAG 233 Query: 260 VEPDLITMAKSLAGGMPLSAVSGRAAIMDAPLPGGLGGTYAGNPLAVAAAHAVIDVIEEE 319 VEPD++ +AK + GG PL A + G G TY GNPLA + +AV+D++ E Sbjct: 234 VEPDVMAIAKGIGGGFPLGAFMATREAAKGMVVGTHGSTYGGNPLATSIGNAVLDIVLEP 293 Query: 320 KLCERSASLGQQLREHLLAQR-KHCPAMAEVRGLGSMVAAEFCDPATGQPSAEHAKRVQT 378 + G L++ L+A R +H +AE+RG G M + P +A A++ Sbjct: 294 SFLAHVEATGVLLQQRLVALRERHPEVIAELRGAGLMRGIKVTLPVADFAAAARAEK--- 350 Query: 379 RALEAGLVLLTCGTYGNVIRFLYPLTIPQAQFDAALAVLTQALA 422 LL NV+R L PL I + + D A+ L A A Sbjct: 351 --------LLVIPAGDNVVRLLPPLIIGEEEVDGAIERLDAACA 386 Lambda K H 0.321 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 405 Length adjustment: 31 Effective length of query: 392 Effective length of database: 374 Effective search space: 146608 Effective search space used: 146608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory