Align 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) (characterized)
to candidate WP_012383496.1 BIND_RS02470 homocitrate synthase
Query= BRENDA::P51017 (346 letters) >NCBI__GCF_000019845.1:WP_012383496.1 Length = 400 Score = 91.7 bits (226), Expect = 3e-23 Identities = 83/278 (29%), Positives = 124/278 (44%), Gaps = 29/278 (10%) Query: 1 MNLHGKSVILHDMSLRDGMHAKRHQISLEQMVAVATGLDQAGMPLIEITHGDGLGGRSIN 60 M+L +IL+D +LRDG A S E+ +A+A L AG+P IE Sbjct: 10 MDLAKTPIILNDTTLRDGEQAPGVAFSPEEKIAIARALALAGVPEIEA------------ 57 Query: 61 YGFPAHSDEEY--LRAVIPQLKQAKV-----------SALLLPGIGTVDHLKMALDCGVS 107 G PA + E + AV+ + +K+ A + G+G ++ D + Sbjct: 58 -GTPAMGEREIAAINAVVAEGLPSKIIAWCRMVPQDIDAAVASGVGMINLSLPVSDIQLK 116 Query: 108 TIRVATHCTEADVSEQHIGMARKLGVDTVGFLMMAHMISAEKVLEQAKLMESYGANCIYC 167 A ++ + I AR G++ A + +LE A+L S G + Sbjct: 117 AKFGAGRAYARELIGRFIPYARDKGLEVALGCEDASRADVDFLLEVAELGASLGVRRMRF 176 Query: 168 TDSAGYMLPDEVSEKIGLLRAELNPATEVGFHGHHNMGMAIANSLAAIEAGAARIDGSVA 227 D+ G + P I LR + E+ H H ++G+A AN+LAA+ AGA +V Sbjct: 177 ADTLGVLDPFMTFAMIERLRQASD--LEIEIHAHDDLGLATANTLAALRAGATHASVTVV 234 Query: 228 GLGAGAGNTPL-EVFVAVCKRMGVETGIDLYKIMDVAE 264 GLG AGN PL EV VAV G TG+DL + VA+ Sbjct: 235 GLGERAGNAPLEEVAVAVEALYGFTTGVDLTALAQVAQ 272 Lambda K H 0.320 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 400 Length adjustment: 30 Effective length of query: 316 Effective length of database: 370 Effective search space: 116920 Effective search space used: 116920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory