Protein WP_012384590.1 in Beijerinckia indica ATCC 9039
Annotation: NCBI__GCF_000019845.1:WP_012384590.1
Length: 391 amino acids
Source: GCF_000019845.1 in NCBI
Candidate for 29 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| D-alanine catabolism | Pf6N2E2_5403 | med | ABC transporter for D-Alanine, permease component 2 (characterized) | 47% | 100% | 330.1 | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 | 46% | 325.5 |
| L-histidine catabolism | aapQ | med | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (characterized) | 46% | 100% | 325.5 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-asparagine catabolism | aapQ | med | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 47% | 94% | 318.2 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-aspartate catabolism | aapQ | med | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 47% | 94% | 318.2 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-glutamate catabolism | aapQ | med | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 47% | 94% | 318.2 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-leucine catabolism | aapQ | med | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 47% | 94% | 318.2 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-proline catabolism | aapQ | med | AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 47% | 94% | 318.2 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-asparagine catabolism | bztB | med | glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) | 41% | 96% | 263.5 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-aspartate catabolism | bztB | med | glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) | 41% | 96% | 263.5 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-glutamate catabolism | bztB | med | glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) | 41% | 96% | 263.5 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-asparagine catabolism | bgtB' | med | ABC-type permease for basic amino acids and glutamine (characterized, see rationale) | 42% | 95% | 260 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-aspartate catabolism | bgtB' | med | ABC-type permease for basic amino acids and glutamine (characterized, see rationale) | 42% | 95% | 260 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-asparagine catabolism | natG | med | NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) | 45% | 75% | 155.2 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-aspartate catabolism | natG | med | NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) | 45% | 75% | 155.2 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-histidine catabolism | Ac3H11_2554 | lo | ABC transporter for L-Histidine, permease component 1 (characterized) | 34% | 91% | 105.1 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-glutamate catabolism | gltJ | lo | Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized) | 38% | 52% | 90.5 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-asparagine catabolism | aatQ | lo | PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) | 37% | 52% | 89.4 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-aspartate catabolism | aatQ | lo | PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) | 37% | 52% | 89.4 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-glutamate catabolism | gluC | lo | GluC aka CGL1952, component of Glutamate porter (characterized) | 35% | 55% | 81.3 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-glutamate catabolism | gluD | lo | GluD aka CGL1953, component of Glutamate porter (characterized) | 32% | 74% | 79.7 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-histidine catabolism | BPHYT_RS24010 | lo | Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale) | 36% | 52% | 75.1 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-lysine catabolism | hisQ | lo | Amino acid ABC transporter, membrane protein (characterized, see rationale) | 30% | 80% | 75.1 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-arginine catabolism | artM | lo | Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 34% | 53% | 74.3 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-histidine catabolism | hisM | lo | Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 34% | 53% | 74.3 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-lysine catabolism | hisM | lo | Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 34% | 53% | 74.3 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| D-glucosamine (chitosamine) catabolism | AO353_21720 | lo | ABC transporter for D-Glucosamine, permease component 1 (characterized) | 33% | 58% | 72 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-asparagine catabolism | peb1D | lo | Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) | 31% | 61% | 70.9 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-aspartate catabolism | peb1D | lo | Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) | 31% | 61% | 70.9 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
| L-citrulline catabolism | AO353_03045 | lo | ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) | 31% | 50% | 58.5 | ABC transporter for D-Alanine, permease component 2 | 47% | 330.1 |
Sequence Analysis Tools
View WP_012384590.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSLSDQSATDRATLLAVWRDPRKRGFIVQALFVLALCLVLVGMFTTLHANMVARGIPTDF
SFWNQTAGFDINQTPIAYSPLSTYGRAFLVGLINTLIVASIGLVCTTIIGVIVGISRLSK
NRLVSFLAATYVETLRNIPLLLQLLFWYNAILKPLPGPRQSLLFPFGTVLNNRGLFLPLP
SLLPGAAWVGAALALGLAASFLVGRGTALKPGWPKTLLCLVLALGPAIIAAMLAPPLAFD
RPILKGFNYTGGFRVLPELVALLLGLSLYTAAFIAEIIRAGIMAVPRGQSEAAEALGLPS
GLTMRRIILPQALRVVIPPLTSQYLNLIKNSSLAVFIGYPDLVQVFAGTVLNQTGAAVQI
IFITMAVYLAVSLVTSFAMNLINRRMALVER
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory