Align Enoyl-CoA hydratase (characterized, see rationale)
to candidate WP_012384775.1 BIND_RS09070 enoyl-CoA hydratase/isomerase family protein
Query= uniprot:A0A2Z5MEB0 (258 letters) >NCBI__GCF_000019845.1:WP_012384775.1 Length = 354 Score = 82.4 bits (202), Expect = 1e-20 Identities = 64/213 (30%), Positives = 101/213 (47%), Gaps = 17/213 (7%) Query: 6 ILVETRGRVGLVTLSRPKALNALNDALMDELGVALREFDADDAIGAIVLTGSE-KAFAAG 64 IL E +G G++TL+RPKALNAL+ + AL + + + +V+ G+ KAF AG Sbjct: 6 ILTEQQGACGIITLNRPKALNALDTETILVFNQALDTLERESGVKTVVVRGAGGKAFCAG 65 Query: 65 AD------IGMMSTYS-YMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMC 117 D +G ++ +D ++ +Y + + KP ++ + G +GGG +++ Sbjct: 66 GDMKFIYELGKAGRHAEQLDFFRLEYQLNH--RIARFPKPYVSLLEGIVMGGGAGISLHA 123 Query: 118 DMIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLV 177 A + F PE +G +P G T LPR K A L +T + + GL Sbjct: 124 PHRVAGENFLFAMPETAIGFIPDVGATYFLPRLPGKLGAY-LAMTGARLGCGDGVAFGLA 182 Query: 178 SRVIPAA---SLIDESIA---AGATIAEFPLPA 204 + IP A +LI + A AGA IA PA Sbjct: 183 TAFIPVAQHEALIAKLAAGEEAGAAIAILNAPA 215 Lambda K H 0.322 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 354 Length adjustment: 27 Effective length of query: 231 Effective length of database: 327 Effective search space: 75537 Effective search space used: 75537 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory