Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_012385186.1 BIND_RS11195 enoyl-CoA hydratase
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_000019845.1:WP_012385186.1 Length = 262 Score = 102 bits (253), Expect = 1e-26 Identities = 72/248 (29%), Positives = 116/248 (46%), Gaps = 8/248 (3%) Query: 12 VLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITG-NARFFAAGADLNEMAE 70 + + + +ARNA+ A+ L A D SI V V+ G + F AG D+ + Sbjct: 19 IAYIVFDHQSARNAMTWAMYDDLATACAAIDADPSIRVAVLRGAGGKAFVAGTDIAQFQT 78 Query: 71 --KDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAGENARFGLP 128 D + A L+ P IA V GYA+G G +A CD+ ++ ARFG+P Sbjct: 79 FTGDDGVAYEAKVDRFIATLENLRVPTIAVVEGYAVGGGLAIANACDIRLSATGARFGVP 138 Query: 129 EI-TLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLEYA 187 TLG A +RL+ ++G S +M+L E TA+Q G + V + Sbjct: 139 IARTLGNCLSAANVRRLVAALGISWVKRMLLLAEMPTAEQLAAIGYLETVATPEQLDGEV 198 Query: 188 LQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEGISAFLQK 247 +L +++ H+PL ++A+++ LR+ +QA L +ED H ++AF K Sbjct: 199 TRLCNRLLEHAPLTIKASRETLRR----LVQASDPDISDLIHACYGSEDFHRAVAAFGSK 254 Query: 248 RTPDFKGR 255 D++GR Sbjct: 255 NKTDWQGR 262 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 96 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory