Protein WP_012385419.1 in Beijerinckia indica ATCC 9039

Annotation: NCBI__GCF_000019845.1:WP_012385419.1

Length: 368 amino acids

Source: GCF_000019845.1 in NCBI

Candidate for 35 steps in catabolism of small carbon sources

Pathway	Step	Score	Similar to	Id.	Cov.	Bits	Other hit	Other id.	Other bits
L-histidine catabolism	PA5503	med	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)	51%	96%	314.7	Methionine import ATP-binding protein MetN; EC 7.4.2.11	48%	307.8
L-arginine catabolism	artP	med	Arginine transport ATP-binding protein ArtM (characterized)	41%	99%	186.8	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
D-glucosamine (chitosamine) catabolism	AO353_21725	med	ABC transporter for D-glucosamine, ATPase component (characterized)	41%	95%	184.5	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-asparagine catabolism	glnQ	med	Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized)	42%	92%	181.8	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-glutamate catabolism	gltL	med	Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized)	42%	92%	181.8	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-histidine catabolism	aapP	lo	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)	40%	95%	188.3	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
D-alanine catabolism	Pf6N2E2_5405	lo	ABC transporter for D-Alanine, ATPase component (characterized)	40%	95%	188	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-asparagine catabolism	aapP	lo	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	39%	98%	188	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-aspartate catabolism	aapP	lo	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	39%	98%	188	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-glutamate catabolism	aapP	lo	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	39%	98%	188	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-leucine catabolism	aapP	lo	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	39%	98%	188	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-proline catabolism	aapP	lo	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	39%	98%	188	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-asparagine catabolism	bztD	lo	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	39%	94%	186.8	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-aspartate catabolism	bztD	lo	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	39%	94%	186.8	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-asparagine catabolism	peb1C	lo	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	40%	98%	182.6	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-aspartate catabolism	peb1C	lo	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	40%	98%	182.6	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-lysine catabolism	hisP	lo	Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)	38%	98%	181.8	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-histidine catabolism	hisP	lo	histidine transport ATP-binding protein hisP (characterized)	39%	99%	179.9	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-citrulline catabolism	AO353_03040	lo	ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)	35%	98%	175.6	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-histidine catabolism	BPHYT_RS24015	lo	ABC transporter related (characterized, see rationale)	39%	98%	175.3	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-citrulline catabolism	PS417_17605	lo	ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)	38%	91%	172.9	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-asparagine catabolism	bgtA	lo	ATPase (characterized, see rationale)	37%	97%	168.3	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-aspartate catabolism	bgtA	lo	ATPase (characterized, see rationale)	37%	97%	168.3	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-histidine catabolism	bgtA	lo	BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)	37%	98%	168.3	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-asparagine catabolism	aatP	lo	Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)	39%	98%	164.9	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-aspartate catabolism	aatP	lo	Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)	39%	98%	164.9	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-proline catabolism	opuBA	lo	BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)	38%	58%	163.3	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-histidine catabolism	hutV	lo	ABC transporter for L-Histidine, ATPase component (characterized)	40%	88%	162.2	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-proline catabolism	hutV	lo	HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)	38%	93%	159.1	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-tryptophan catabolism	ecfA2	lo	Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)	36%	96%	147.1	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-tryptophan catabolism	ecfA1	lo	Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)	37%	74%	134.4	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-isoleucine catabolism	livF	lo	High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)	31%	97%	109.4	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-phenylalanine catabolism	livF	lo	High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)	31%	97%	109.4	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-leucine catabolism	livF	lo	High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)	30%	97%	104.4	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7
L-valine catabolism	livF	lo	High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)	30%	97%	104.4	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN	51%	314.7

Sequence Analysis Tools

View WP_012385419.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNAPVIFQREGRAIEGEASASEALIRFENVRKTYTTHHGGSVAALEDVNLAIKQGSILGV
IGRSGAGKSTLIRLVNGLEKPDSGQIIVDSIDISRLAEKDLRKVRRSIGMIFQHFNLLSS
RTVFGNIALPLEIGGLRKSEIQDRVEHLLTLVGLTDKRNHYPAELSGGQKQRVGIARALA
TRPKVLLCDEATSALDPETTASILQLLASINRDLGVTILLITHEMAVIRAIAHEIAVLDA
GRIVEQGDAYDLFTRPQHPTTLRFLQSETGHQLPAYLAERLRPQAFAGALAVLRVGFRGA
FAHDGILSHLTRKLNCDVNILGGAIDAVADRPFGTLIIGLPAGEALANQARHFLSERGHD
AEFLGYVA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.