Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_012385421.1 BIND_RS12435 mannitol dehydrogenase family protein
Query= BRENDA::Q9KWR5 (485 letters) >NCBI__GCF_000019845.1:WP_012385421.1 Length = 589 Score = 288 bits (736), Expect = 5e-82 Identities = 157/417 (37%), Positives = 231/417 (55%), Gaps = 7/417 (1%) Query: 6 TLKSLPANVQAPPYDIDGIKPGIVHFGVGNFFRAHEAFYVEQILEHAPD--WAIVGVGLT 63 TL A P Y + GIVHFG+GNF RAH+A Y++++ D WAI+G G+ Sbjct: 9 TLNEATAPTAVPTYARQSLSAGIVHFGIGNFHRAHQAVYLDELFNAGQDLDWAIIGAGVM 68 Query: 64 GSDRSKKKAEEFKAQDCLYSLTETAPSGKSTVRVMGALRDYLLAPADPEAVLKHLVDPAI 123 SD + E+ QDCL ++ E + + R+ GA+ D +L + +++ L +PAI Sbjct: 69 PSDALIR--EKLLDQDCLTTVVEQ-DNNRVAARITGAMID-ILPTGNAPVIIEKLAEPAI 124 Query: 124 RIVSMTITEGGYNINETTGAFDLENAAVKADLKNPEKPSTVFGYVVEALRRRWDAGGKAF 183 RIVSMTITEGGY +N GAF+LE+ A+ D ++PE P T+FG +V L+ R + G + F Sbjct: 125 RIVSMTITEGGYFLN-ANGAFNLEHPAIIEDGRHPESPKTIFGLIVAGLKARKEKGIEPF 183 Query: 184 TVMSCDNLRHNGNVARKAFLGYAKARDPELAKWIEENATFPNGMVDRITPTVSAEIAKKL 243 TV SCDN+ HNG V A G A+ DP+ A WI N +FPN MVDRITP Sbjct: 184 TVASCDNIPHNGKVTYNAVTGLARLSDPDFANWIAANVSFPNSMVDRITPATGQREIDIA 243 Query: 244 NAASGLDDDLPLVAEDFHQWVLEDQFADGRPPLEKAGVQMVGDVTDWEYVKIRMLNAGHV 303 G++D+ P+ E+F QWV+ED+F GRP LEK GVQ V DV+ +E +KIR+LN GH Sbjct: 244 REDFGIEDNWPVFCEEFRQWVIEDKFPAGRPALEKVGVQFVLDVSPYELMKIRILNGGHA 303 Query: 304 MLCFPGILVGYENVDDAIEDSELLGNLKNYLNKDVIPTLKAPSGMTLEGYRDSVISRFSN 363 + +P L+ V +A+E+ + L +++IP + ++ Y + RFSN Sbjct: 304 AIAYPAALLDIHFVHEAMEEPLIRSFLAKLEREEIIPVVPPVPDTDIDAYFQLIERRFSN 363 Query: 364 KAMSDQTLRIASDGCSKVQVFWTETVRRAIEDKRDLSRIAFGIASYLEMLRGRDEKG 420 + D R+A DG ++ F T + + D+ ++ A + G + G Sbjct: 364 SKIGDTIPRLAQDGSNRQPKFILPTTKDRLARGDDVIGLSLVSALWCRYFAGTSDSG 420 Lambda K H 0.317 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 714 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 589 Length adjustment: 35 Effective length of query: 450 Effective length of database: 554 Effective search space: 249300 Effective search space used: 249300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory