Align Acetate/monochloroacetate permease, Deh4p, of 468 aas and 12 TMSs (characterized)
to candidate WP_012385490.1 BIND_RS12805 MFS transporter
Query= TCDB::M1Q159 (468 letters) >NCBI__GCF_000019845.1:WP_012385490.1 Length = 439 Score = 206 bits (523), Expect = 2e-57 Identities = 136/408 (33%), Positives = 204/408 (50%), Gaps = 24/408 (5%) Query: 15 KVIFASSAGTVIEWYDFYIFGALATTLASKFYNTGTPIGDIIAWLGTFAVGFLVRPFGAI 74 + AS GT IEWYDF+I+G A + K Y ++ T VGFL RP GA Sbjct: 16 RAAIASVIGTTIEWYDFFIYGTAAALIFPKLYFGAGASEGLMESFSTIFVGFLSRPIGAA 75 Query: 75 VFGRIGDLVGRKFTYLITITIMGSCTFLIGLLPTQDVLGAWAGIILITMRILQGLALGGQ 134 +FG IGD VGRK T + T+T+MG T L+G+LP + +GAWAG L+ +R QG+ +GG+ Sbjct: 76 LFGHIGDRVGRKATLVATLTLMGVATVLVGILPDRTSIGAWAGWGLVVLRFFQGIGVGGE 135 Query: 135 YGGAATFVAEHAPQGKRGFYTSWIQTTATFGLLISLGVILITRISL-GEADFNEWGWRLP 193 +GGA E +RGF S GL++S V+ + S + + WR+P Sbjct: 136 WGGAVLLSMESHQGDRRGFMASLPHIGVPLGLVVS--VLAWSACSYWSGGNLEDGAWRIP 193 Query: 194 FMASILLVILSLWIRRALKESPLFQQLKDTKAVSKNPLKESFANPYNLRWVLIALFGATM 253 F+AS L++ L +R + E+P F + + S PL E+ + R +L+A Sbjct: 194 FLASGALLVFGLVVRLGVPETPDFVKAQREVRASMPPLIEAIKTQW--RSILLAALIRPG 251 Query: 254 GQGVVWYTGQFYALFYLQKI-FNTPLIDSNLIVGAALLLSMPFFVFFGSLSDRIGRKKVM 312 Q + F L+ ++ + + +++GA + S +FG L DRIGR+++ Sbjct: 252 EQASFYMLSTFVVLYGSAQLGLGREFMLNAVLLGA--VASCFMVPYFGHLGDRIGRRRIY 309 Query: 313 LSGMLLAVLTYYPIYGLMAAFAPTDPGQHFLFAYIGYNPVILGLLVFIQVIYVTMVYGPI 372 L+G ++ L P + L+ D Q L ILGL+ M+YGP Sbjct: 310 LTGAIVMTLFALPYFWLL------DTRQPILVIV-----AILGLMAAHD-----MMYGPQ 353 Query: 373 AAFLVELFPTKIRYTSMSLPYHIGNGVFGGLVPMIGLILINATGNDFA 420 AA++ E FP IRYT SL Y + + GG P++ L L N G +A Sbjct: 354 AAYITESFPAHIRYTGASLGYQSASIIAGGPAPLVSLWLFNTFGTGYA 401 Lambda K H 0.328 0.144 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 676 Number of extensions: 43 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 439 Length adjustment: 33 Effective length of query: 435 Effective length of database: 406 Effective search space: 176610 Effective search space used: 176610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory