Align 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate WP_012385734.1 BIND_RS14190 ornithine--oxo-acid transaminase
Query= BRENDA::Q0K2K2 (423 letters) >NCBI__GCF_000019845.1:WP_012385734.1 Length = 412 Score = 214 bits (545), Expect = 4e-60 Identities = 146/401 (36%), Positives = 203/401 (50%), Gaps = 43/401 (10%) Query: 32 ENATLWDVEGRAYTDFAAGIAVLNTGHRHPRVMQAIAAQLERF--THTAYQIVPYQGYVT 89 + A L+D +GR Y D + + + GH HPR++ A+ QLER AY T Sbjct: 28 QGAFLFDCDGRRYLDMMSAYSAASFGHLHPRLVGALKRQLERLDLVSRAYHTD------T 81 Query: 90 LAERINALVPIQGLNKTALFTTGAEAVENAIKIARAH--------TGRPGVIAFSGAFHG 141 L L + GL+ TGAEAVE AIK AR + + +I +G FHG Sbjct: 82 LGPFCEDLARLTGLDACLPMNTGAEAVETAIKAARRYGYDRLSIPEDQAEIIVAAGNFHG 141 Query: 142 RTLLGMALTGKVAPYKIGFGPFPSDIYHAPFPSALHGVSTERALQALEGLFKTDIDPARV 201 RT + + A + GFGPF PF A AL+A G R Sbjct: 142 RTTTIIGFSSDAATRR-GFGPFAPGFVLVPFGDA-------GALEAAVG--------PRT 185 Query: 202 AAIIVEPVQGEGGFQAAPADFMRGLRAVCDQHGIVLIADEVQTGFGRTGKMFAMSHHDVE 261 AA+++EP+QGE G P ++ LR +CD+HGI+LI DEVQ+GFGRTG+ FA H + Sbjct: 186 AAVLIEPIQGEAGIILPPPGYLAALRRLCDRHGILLIFDEVQSGFGRTGRTFAFEHEGAK 245 Query: 262 PDLITMAKSLAGG-MPLSAVSGRAAIMDAPLPGGLGGTYAGNPLAVAAAHAVIDVIEEEK 320 PD + + K+L GG +P+SA + + ++MD PG G T+ GNPLA+A A + V++EE Sbjct: 246 PDGLILGKALGGGLLPVSAFAAKRSLMDVFDPGSHGSTFGGNPLAMAVAREAMHVLQEEH 305 Query: 321 LCERSASLGQQLREHLLAQRKHCPAMAEVRGLGSMVAAEFCDPATGQPSAEHAKRVQTRA 380 L ERS LG L + L A PA+ VRG G + P+ AK+V + Sbjct: 306 LVERSEKLGGVLLDALRAIDH--PAVLAVRGKGLWAGVDL------DPALADAKKVCLKM 357 Query: 381 LEAGLVLLTCGTYGNVIRFLYPLTIPQAQFDAALAVLTQAL 421 +E G +LT T+ IRF PL I +A A+ + L Sbjct: 358 MERG--VLTKETHATTIRFAPPLVITEADLLEAVGIFRAVL 396 Lambda K H 0.321 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 33 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 412 Length adjustment: 32 Effective length of query: 391 Effective length of database: 380 Effective search space: 148580 Effective search space used: 148580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory