Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_012385734.1 BIND_RS14190 ornithine--oxo-acid transaminase
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_000019845.1:WP_012385734.1 Length = 412 Score = 228 bits (581), Expect = 3e-64 Identities = 142/366 (38%), Positives = 205/366 (56%), Gaps = 23/366 (6%) Query: 76 LVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAA 135 L D G+ ++D + + + GH +P +V A++ QL + L S+ + LA Sbjct: 32 LFDCDGRRYLDMMSAYSAASFGHLHPRLVGALKRQLERLDLVSRAYHTDTLGPFCEDLAR 91 Query: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAY-----QSPRGKFTFIATSGAFHGKSLGALSA 190 LT L N+G E+VE A+K A+ Y P + I +G FHG++ + Sbjct: 92 LTG--LDACLPMNTGAEAVETAIKAARRYGYDRLSIPEDQAEIIVAAGNFHGRTTTIIGF 149 Query: 191 TAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPP 250 ++ + R+ F P PGF VPFG+ A+ A+ G AAV++EPIQGE G+ILPP Sbjct: 150 SSDAATRRGFGPFAPGFVLVPFGDAGALEAAV------GPRTAAVLIEPIQGEAGIILPP 203 Query: 251 PGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIG 310 PGYL A+R+LCD G L+I DEVQ+G GRTG+ FA EHE +PD L L KALGGG++P+ Sbjct: 204 PGYLAALRRLCDRHGILLIFDEVQSGFGRTGRTFAFEHEGAKPDGLILGKALGGGLLPVS 263 Query: 311 ATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGF 370 A A + V +P H +TFGGNPLA A A ++VL E++L ++E+ G +LLD Sbjct: 264 AFAAKRSLMDVF--DPGSHGSTFGGNPLAMAVAREAMHVLQEEHLVERSEKLGGVLLDAL 321 Query: 371 RQLAREYPDLVQEARGKGMLMAIEFVDNEI--GYNFASEMFRQRVLVAGTLNNAKTIRIE 428 R A ++P V RGKG+ ++ +D + +M + VL T +A TIR Sbjct: 322 R--AIDHP-AVLAVRGKGLWAGVD-LDPALADAKKVCLKMMERGVLTKET--HATTIRFA 375 Query: 429 PPLTLT 434 PPL +T Sbjct: 376 PPLVIT 381 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 40 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 412 Length adjustment: 32 Effective length of query: 427 Effective length of database: 380 Effective search space: 162260 Effective search space used: 162260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory