Align Myo-inosose-2 dehydratase (EC 4.2.1.44) (characterized)
to candidate WP_012385755.1 BIND_RS14295 myo-inosose-2 dehydratase
Query= reanno::BFirm:BPHYT_RS13920 (305 letters) >NCBI__GCF_000019845.1:WP_012385755.1 Length = 310 Score = 268 bits (686), Expect = 9e-77 Identities = 138/287 (48%), Positives = 176/287 (61%), Gaps = 2/287 (0%) Query: 7 RIGINPLSWMNDDLPSLGGETPLEVALTEGREIGYQGFELGNKFPREPQALKSLLAQYDL 66 ++GI P++W NDDLP LGG+T LE L E R G+ G E G KFP+ L LA + L Sbjct: 4 KLGIAPIAWSNDDLPELGGQTSLETCLRESRAAGFSGVETGGKFPKTAAELGPKLAAFGL 63 Query: 67 ALVSGWYSGRL--ARRSVEEEIAEVGPHLELLAQNGATAMVYGEVADSIQGAAQPLYQRP 124 +L SGWYSG + A + E + L+L + GA + YGE A +IQ Sbjct: 64 SLASGWYSGTVLDAPDDLAAEKEKAASQLQLFRELGAACLAYGETAGTIQNKRTAPLNSR 123 Query: 125 RFFSEKQWADYAARVDEFARYTLSRGVRLAYHHHMGAYVETPADVDQLMARTSDAVGLLF 184 R +E Q Y R+ FA Y +GV L +HHHMG +ET D+D LM T +AVGLL+ Sbjct: 124 RRLAEDQIRTYGHRLTRFAEYCSEKGVPLGFHHHMGTGIETEEDLDLLMRHTGEAVGLLY 183 Query: 185 DAGHITFAGGDPLAVLDKHIGRVCHVHCKDVRPAVMKLARNRNWSFLDAVIAGAFTVPGD 244 D GH+ FAGGD L V++KH R+ HVH KDVR V+ + SFLDAV+AGAFTVPGD Sbjct: 184 DTGHMRFAGGDHLRVIEKHGRRIIHVHAKDVRDQVISSLDRSHDSFLDAVLAGAFTVPGD 243 Query: 245 GAVNFPAIIERLKRHGYCGWLVVEAEQDPVVAPSFEYAQKGYKTLRA 291 G+++F A+ +RL GY GW +VEAEQDPV AP EYA GY+ L A Sbjct: 244 GSIDFNAVAQRLSDVGYQGWFIVEAEQDPVKAPPAEYAVIGYRALSA 290 Lambda K H 0.320 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 310 Length adjustment: 27 Effective length of query: 278 Effective length of database: 283 Effective search space: 78674 Effective search space used: 78674 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_012385755.1 BIND_RS14295 (myo-inosose-2 dehydratase)
to HMM TIGR04379 (iolE: myo-inosose-2 dehydratase (EC 4.2.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR04379.hmm # target sequence database: /tmp/gapView.675873.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR04379 [M=290] Accession: TIGR04379 Description: myo_inos_iolE: myo-inosose-2 dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-120 387.5 0.0 2.6e-120 387.3 0.0 1.0 1 NCBI__GCF_000019845.1:WP_012385755.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000019845.1:WP_012385755.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 387.3 0.0 2.6e-120 2.6e-120 2 288 .. 3 290 .. 2 292 .. 0.98 Alignments for each domain: == domain 1 score: 387.3 bits; conditional E-value: 2.6e-120 TIGR04379 2 vklgiaPiaWvndDlpelggdttleqvlseaaeagfsgtElgnkfpkdpavLkaaleerglelvsgwfsalll 74 +klgiaPiaW+ndDlpelgg+t+le++l+e ++agfsg+E+g kfpk++a+L ++l +gl+l+sgw+s+++l NCBI__GCF_000019845.1:WP_012385755.1 3 AKLGIAPIAWSNDDLPELGGQTSLETCLRESRAAGFSGVETGGKFPKTAAELGPKLAAFGLSLASGWYSGTVL 75 59*********************************************************************99 PP TIGR04379 75 ..eksveeeieavrehlellkalgakvivvaEvgksiqgdkdtplaerpklteeeweelaeklnklgeilkek 145 +++++e+e+ +++l+l+++lga+++ ++E++++iq+++++pl++r++l e+++++++++l++++e+++ek NCBI__GCF_000019845.1:WP_012385755.1 76 daPDDLAAEKEKAASQLQLFRELGAACLAYGETAGTIQNKRTAPLNSRRRLAEDQIRTYGHRLTRFAEYCSEK 148 6667899****************************************************************** PP TIGR04379 146 glklayHhHlgtvveteeeidrlmeltdpelvgllyDtGHlvfagedplavlekyadRiahvHlKDvRkevle 218 g++l +HhH+gt++etee++d lm +t+++ vgllyDtGH+ fag+d l+v+ek+++Ri hvH+KDvR +v++ NCBI__GCF_000019845.1:WP_012385755.1 149 GVPLGFHHHMGTGIETEEDLDLLMRHTGEA-VGLLYDTGHMRFAGGDHLRVIEKHGRRIIHVHAKDVRDQVIS 220 ****************************99.****************************************** PP TIGR04379 219 evrkekksFldavlkGvftvPGdGcidfeeilealkakdYeGWlvvEaEqDPakaepleyakkakkylee 288 +++++++sFldavl+G+ftvPGdG+idf+++++ l+ +Y+GW++vEaEqDP ka+p eya ++++ l++ NCBI__GCF_000019845.1:WP_012385755.1 221 SLDRSHDSFLDAVLAGAFTVPGDGSIDFNAVAQRLSDVGYQGWFIVEAEQDPVKAPPAEYAVIGYRALSA 290 *****************************************************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 18.44 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory