Align fumarylacetoacetate hydrolase (EC 3.7.1.2) (characterized)
to candidate WP_012399618.1 BPHY_RS00980 FAA hydrolase family protein
Query= reanno::MR1:200835 (328 letters) >NCBI__GCF_000020045.1:WP_012399618.1 Length = 330 Score = 435 bits (1118), Expect = e-127 Identities = 212/328 (64%), Positives = 252/328 (76%) Query: 1 MKLASYNNGRRDGQLMLVSRDLTQTVAVPAIAHTMQQLLDGWELLKPQLQELYDALNEGK 60 MKLAS +G RDGQL++VSRDL IA TMQ++LD W PQL++LYD LN+G+ Sbjct: 1 MKLASLKDGTRDGQLIVVSRDLHTAAVADTIAPTMQRILDDWTFYAPQLRDLYDELNQGR 60 Query: 61 LPNTQTFDETKCLSPLPRAYQWADGSAYVNHVELVRKARGAEMPETFWTDPLFYQGGSDS 120 NT +FD +C++PLPRAYQWADGSAYVNHVELVR+ARGAEMP FWTDPL YQGGSD Sbjct: 61 ARNTFSFDAKECMAPLPRAYQWADGSAYVNHVELVRRARGAEMPPEFWTDPLMYQGGSDD 120 Query: 121 FIAPKADIPLASEDWGIDFESEIAVITDDVPMGVSAENAAKHIKLLMLVNDVSLRNLIPA 180 FI K DI ASE +GIDFE+E+AVIT DVPMG E A K I+L+ LVNDVSLRNLIPA Sbjct: 121 FIGAKDDIVCASESFGIDFEAEVAVITGDVPMGAKPEQALKSIRLVTLVNDVSLRNLIPA 180 Query: 181 ELAKGFGFFQSKPSSSFSPVAITPDELGHRWEDSKVHLPLITYLNGELFGRPNAGVDMTF 240 ELAKGFGFFQSKP++SF+PVA+T DELG W + +VH P+I + NG+ G+P+AG DM F Sbjct: 181 ELAKGFGFFQSKPATSFAPVAVTLDELGDAWREGRVHRPMIVHWNGKKVGQPDAGTDMVF 240 Query: 241 NFSQLVSHVAKTRPLGAGAIIGSGTISNYDRSAGSSCLAEKRMLEVIADGKASTPFMRFG 300 NF QL++H AKTR L AGAI+GSGT+SN D G C+AEKR LE I G A T FMRFG Sbjct: 241 NFGQLIAHAAKTRHLRAGAIVGSGTVSNKDAKRGYCCIAEKRCLETIESGSAQTEFMRFG 300 Query: 301 DTVRIEMLDDNGVSIFGSIDQKVVEYKA 328 DTV+IEM D+ G +IFGSIDQ V ++A Sbjct: 301 DTVKIEMFDEAGKTIFGSIDQAVAPFEA 328 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 330 Length adjustment: 28 Effective length of query: 300 Effective length of database: 302 Effective search space: 90600 Effective search space used: 90600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory