Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_012401373.1 BPHY_RS10120 enoyl-CoA hydratase
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_000020045.1:WP_012401373.1 Length = 262 Score = 142 bits (357), Expect = 9e-39 Identities = 89/260 (34%), Positives = 141/260 (54%), Gaps = 8/260 (3%) Query: 2 SELIVSR---QQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARF 58 +EL+ SR + L+LTL+ P ARNA++ + + + A D SI VITG F Sbjct: 3 AELLASRPTESESTLVLTLSNPGARNAMHPDMYAAGIEAMNTAERDASIGAIVITGADNF 62 Query: 59 FAAGADLNEMAEK-----DLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALL 113 F AG +LN + E + A D + A LQA +KP+IAAV G A GAG LAL Sbjct: 63 FCAGGNLNRLLENRAKDPSVQAQSIDLLGEWIAALQASSKPVIAAVEGAAAGAGFSLALA 122 Query: 114 CDVVVAGENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGL 173 CD++VA ++A+F + +G+ P GG+ L R++ + +A+++++ G+ I A + + G+ Sbjct: 123 CDLIVAADDAKFVMSYARVGLTPDGGGSWFLARALPRQIATEVLIEGKPIGAPRLYELGV 182 Query: 174 VSDVFPSDLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAA 233 V+ + + A+ A + + SP A K + + E +L L ER F Sbjct: 183 VNRLAKPGAVRDAAVAWADDLGKVSPNAKARIKGLIAAAGEQSLPDQLVAERDSFVASLH 242 Query: 234 TEDRHEGISAFLQKRTPDFK 253 D EGI+AFL+KRTP+++ Sbjct: 243 HRDGLEGITAFLEKRTPNYR 262 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory