Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33 (characterized, see rationale)
to candidate WP_012403656.1 BPHY_RS21970 3-isopropylmalate dehydratase small subunit
Query= uniprot:Q845W4 (216 letters) >NCBI__GCF_000020045.1:WP_012403656.1 Length = 217 Score = 416 bits (1069), Expect = e-121 Identities = 197/216 (91%), Positives = 208/216 (96%), Gaps = 1/216 (0%) Query: 1 MEKFTVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDEWRYLDHGEPGQDNSK 60 M+KF VHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDEWRYLDHGEPGQDNSK Sbjct: 1 MDKFIVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDEWRYLDHGEPGQDNSK 60 Query: 61 RPLNPDFVLNQPRYQGASILVTRKNFGCGSSREHAPWALQQYGFRAIIAPSFADIFFNNC 120 RPLNPDFVLNQPRYQGASIL+TR+NFGCGSSREHAPWALQQYGFRAIIAPSFADIF+NNC Sbjct: 61 RPLNPDFVLNQPRYQGASILLTRQNFGCGSSREHAPWALQQYGFRAIIAPSFADIFYNNC 120 Query: 121 FKNGLLPIVLTEQQVDHLINETVAFNGYQLTIDLEAQVVRTPD-GRDYPFEITAFRKYCL 179 FKNGLLPIVLTEQQVDHL NET AFNG+QLT+DLE QVVRT D G +YPFE+ AFRKYCL Sbjct: 121 FKNGLLPIVLTEQQVDHLFNETFAFNGFQLTVDLEKQVVRTTDGGTEYPFEVAAFRKYCL 180 Query: 180 LNGFDDIGLTLRHADKIRQFEAERLAKQPWLNNKLV 215 LNGFDDIGLTLRHADKIRQ+EAER+AKQPWLNN+LV Sbjct: 181 LNGFDDIGLTLRHADKIRQYEAERIAKQPWLNNRLV 216 Lambda K H 0.322 0.141 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 217 Length adjustment: 22 Effective length of query: 194 Effective length of database: 195 Effective search space: 37830 Effective search space used: 37830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_012403656.1 BPHY_RS21970 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.32235.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.32235.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.