Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate WP_012405500.1 BPHY_RS31395 glutathione S-transferase family protein
Query= reanno::MR1:200836 (216 letters) >NCBI__GCF_000020045.1:WP_012405500.1 Length = 267 Score = 49.7 bits (117), Expect = 5e-11 Identities = 39/124 (31%), Positives = 59/124 (47%), Gaps = 6/124 (4%) Query: 9 SSAAYRVRIALNLKGVSAEQLSVHLVRDGGEQHKADYIALNPQELVPTLVVDDEQDGDAL 68 S ++ +VR+AL KG+ V L+ GE + + LN VP L+ D L Sbjct: 10 SVSSQKVRMALAEKGLEWTDCIVDLLT--GEHCQPAFRHLNEWAEVPVLMHGDM----TL 63 Query: 69 TQSLAIIEYLDELYPKTPLLPASALERAHVRAMALTIACEIHPLNNLRVLQYLTQKLTVN 128 S I EYLD++ P+TPL+PA+ +R R L I E+H + + Q L Sbjct: 64 VDSWLICEYLDDVVPQTPLMPATPHDRYLARHWNLWIEREVHEATGMLTYAVMGQPLLAQ 123 Query: 129 EEAK 132 +A+ Sbjct: 124 LDAQ 127 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 267 Length adjustment: 23 Effective length of query: 193 Effective length of database: 244 Effective search space: 47092 Effective search space used: 47092 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory