Align D-galactono-lactonase (EC 3.1.1.-) (characterized)
to candidate WP_012406047.1 BPHY_RS34215 lactonase family protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3314 (389 letters) >NCBI__GCF_000020045.1:WP_012406047.1 Length = 414 Score = 160 bits (406), Expect = 5e-44 Identities = 113/351 (32%), Positives = 174/351 (49%), Gaps = 30/351 (8%) Query: 30 VGSYTAGQ----SQGIYRLAFDSRTGQIDASPLQVIKS-ANPSWLTLSKDQRHLFVVNEN 84 VGS T + +GI D+ TG ++ +Q++K NPS+L LS++ L+ V+ + Sbjct: 66 VGSRTTRERNAHGEGISVYQVDTETGALEL--VQLVKDLVNPSFLALSRNGERLYTVHGD 123 Query: 85 GPGQTDPVGRVSSFAIDPKTHALSLISQVQSLGNEPTHSSLSIDGSHLFVSNYSVAEDPG 144 +S+F +D + L+ +++ + G P H ++ G ++ VSN+ G Sbjct: 124 ASD-------ISAFKVDKASGKLTFLNRQSTQGKNPVHLAIDPLGRYIVVSNHI-----G 171 Query: 145 GTLAVLPVAADGKLKAVVQMSSHPASRVNPER--QASAHVHSTIPSPDGRYVFANDLGAD 202 +LAVLP+AADG L+ + Q+ H V P R Q A H P G +V D G D Sbjct: 172 ASLAVLPIAADGSLQELTQLV-HLEGPVGPHRVEQKQAKPHFNPFDPTGEFVIVPDKGLD 230 Query: 203 KVFAYRFDPKANPELPLTPATPAFVQLPPGSGPRHLLFSADGKHAWLTMEMSAQVAVFDY 262 +VF +RF + LTPATP FV +GPRH+ F G +A++ E+ + V + Y Sbjct: 231 RVFTFRFK-----DGQLTPATPGFVVSRETAGPRHVAFHPKGAYAYVVNELDSTVTTYRY 285 Query: 263 HDGQ--LEQTQMVDLAAGQPVSDKAAAALHASADGKFLYVSNRGTANQLLVFAIDPATGH 320 G L Q+V + A+ + G+F+Y SNRG + + VF ID ATGH Sbjct: 286 SSGNGALTPVQIVSSLPDTYTGNSRASEIEVDPSGRFVYASNRGF-DSIAVFRIDQATGH 344 Query: 321 LSELQRRAVEGDHPREFSLDPSGKFLLIANQKSNQIVVVERDARTGLLGKT 371 L+ + G PR + P G+F+ N+ S+ IV +A TG L T Sbjct: 345 LTFIDAEPTLGRTPRFMTGTPDGRFMYALNEDSDTIVAFAVNAATGQLKPT 395 Lambda K H 0.316 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 524 Number of extensions: 41 Number of successful extensions: 13 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 414 Length adjustment: 31 Effective length of query: 358 Effective length of database: 383 Effective search space: 137114 Effective search space used: 137114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory