Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate WP_012410913.1 NPUN_RS23195 long-chain-fatty-acid--CoA ligase
Query= BRENDA::A4YDR9 (549 letters) >NCBI__GCF_000020025.1:WP_012410913.1 Length = 495 Score = 171 bits (434), Expect = 5e-47 Identities = 153/519 (29%), Positives = 239/519 (46%), Gaps = 68/519 (13%) Query: 37 DKTAVVYRDSRYTY-STFYDNVMVQASALMRRGFSREDKLSFISRNRPEFLESFFGVPYA 95 +K A+V D +TY Y + + S L +E +++F+ E++ + +G+ A Sbjct: 14 EKIAIVTTDGSFTYRDLLYTSSQIATSLLQNAKDLQEKRVAFLIPPGFEYVATQWGIWRA 73 Query: 96 GGVLVPINFRLSPKEMAYIINHSDSKFVVVDEPYLNSLLEVKDQIKAEIILLEDPDNPSA 155 GG+ VP+ E+ Y+I +S + +V + + L + ++ IL Sbjct: 74 GGIAVPLCVSHPRPELEYVITNSGASIIVAHPNFESILRSLAEEHNLRFIL--------T 125 Query: 156 SETARKEVRMTYRELVKGGSRDPLPIPAKEEYSMITLYYTSGTTGLPKGVMHHHRGAFLN 215 SET V P+P + + YTSGTTG PKGV+ H+ N Sbjct: 126 SETLPSNVA---------------PLPEVDITRRALILYTSGTTGKPKGVVTTHQ----N 166 Query: 216 AMAEVLEHQMDLNSVYLWT--------LPMFHAASWGFSWATVAVGATNVC--LDKVDYP 265 A+V LN+ + WT LP+ H + T A+ A C L K D Sbjct: 167 IQAQVTS----LNTAWEWTSSDRILHILPLHHIHGI-INVLTCALWAGAECHLLSKFDTE 221 Query: 266 LIYRLVEKERVTHMCAAPTVYVNLA----DYMKRNNLKFSN---RVHMLVAGAAPAPA-T 317 ++R + +T A PT+YV L + K S ++ ++V+G+A P Sbjct: 222 TVWRRICDGDLTLFMAVPTIYVKLITAWENASKERQKTMSEGCAKMRLMVSGSAALPVQV 281 Query: 318 LKAMQEIGG-YMCHVYGLTETYGPHSICEWRREWDSLPLEEQAKLKARQGIPYVSFEMDV 376 L+ Q I G ++ YG+TE S PL + +L G P E+ + Sbjct: 282 LEKWQSISGHFLLERYGMTEIGMALSN----------PLHGE-RLAGYVGKPLPKVEVRL 330 Query: 377 FDANGKPVPWDGKTIGEVVMRGHNVALGYYKNPEKTAESFRDGWFHSGDAAVVHPDGYIE 436 D G T GE+ ++G V L Y++NPE TA++F+DGWF +GD AVV + Y Sbjct: 331 VDEKGLV---SAGTPGEIQVKGPGVFLEYWQNPEATAKAFQDGWFCTGDTAVVENENYRI 387 Query: 437 IVDRFKDLINTGGEKVSSILVEKTLMEIPGVKAVAVYGTPDEKWGEVVTARIELQEGVK- 495 + D+I TGG KVS++ +E+ L P ++ AV G D +WGE V A + L +G K Sbjct: 388 LGRMSVDIIKTGGYKVSALEIEEVLRSHPDIQECAVVGVADIEWGERVCAALVLLQGSKP 447 Query: 496 LTEEEVIKFCKERLAHFECP-KIVEFGPIPMTATGKMQK 533 LT E + KERLA ++ P +I+ +P A GK+ K Sbjct: 448 LTLESFRSWAKERLAVYKVPTQILIVEELPRNAMGKVTK 486 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 663 Number of extensions: 39 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 549 Length of database: 495 Length adjustment: 35 Effective length of query: 514 Effective length of database: 460 Effective search space: 236440 Effective search space used: 236440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory