Protein WP_012412537.1 in Nostoc punctiforme ATCC 29133; PCC 73102

Annotation: NCBI__GCF_000020025.1:WP_012412537.1

Length: 496 amino acids

Source: GCF_000020025.1 in NCBI

Candidate for 45 steps in catabolism of small carbon sources

Pathway	Step	Score	Similar to	Id.	Cov.	Bits	Other hit	Other id.	Other bits
L-arginine catabolism	bgtB	med	Basic amino acid uptake transporter, BgtAB (characterized)	33%	95%	254.6	Arginine-binding extracellular protein ArtP	46%	226.1
L-asparagine catabolism	bgtA	med	Basic amino acid uptake transporter, BgtAB (characterized)	33%	95%	254.6	BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter	32%	246.1
L-aspartate catabolism	bgtA	med	Basic amino acid uptake transporter, BgtAB (characterized)	33%	95%	254.6	BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter	32%	246.1
L-histidine catabolism	bgtB	med	Basic amino acid uptake transporter, BgtAB (characterized)	33%	95%	254.6	Arginine-binding extracellular protein ArtP	46%	226.1
L-lysine catabolism	bgtB	med	Basic amino acid uptake transporter, BgtAB (characterized)	33%	95%	254.6	Arginine-binding extracellular protein ArtP	46%	226.1
L-asparagine catabolism	glnP	lo	Glutamine ABC transporter permease and substrate binding protein protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized)	32%	64%	219.9	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-glutamate catabolism	glnP	lo	Glutamine ABC transporter permease and substrate binding protein protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized)	32%	64%	219.9	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-asparagine catabolism	aatM	lo	Glutamate/aspartate import permease protein GltK (characterized)	34%	98%	154.8	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-aspartate catabolism	aatM	lo	Glutamate/aspartate import permease protein GltK (characterized)	34%	98%	154.8	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-glutamate catabolism	gltK	lo	Glutamate/aspartate import permease protein GltK (characterized)	34%	98%	154.8	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-histidine catabolism	Ac3H11_2554	lo	ABC transporter for L-Histidine, permease component 1 (characterized)	36%	97%	140.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-asparagine catabolism	natH	lo	NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)	36%	55%	127.1	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-aspartate catabolism	natH	lo	NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)	36%	55%	127.1	Basic amino acid uptake transporter, BgtAB	33%	254.6
D-glucosamine (chitosamine) catabolism	AO353_21720	lo	ABC transporter for D-Glucosamine, permease component 1 (characterized)	35%	90%	127.1	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-lysine catabolism	argT	lo	ABC transporter for L-Lysine, periplasmic substrate-binding component (characterized)	34%	85%	125.9	Basic amino acid uptake transporter, BgtAB	33%	254.6
D-glucosamine (chitosamine) catabolism	AO353_21715	lo	ABC transporter for D-Glucosamine, permease component 2 (characterized)	32%	97%	122.5	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-lysine catabolism	hisQ	lo	ABC transporter for L-Lysine, permease component 1 (characterized)	35%	92%	120.9	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-arginine catabolism	artJ	lo	Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)	33%	91%	120.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-histidine catabolism	hisJ	lo	Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)	33%	91%	120.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-lysine catabolism	hisM	lo	ABC transporter for L-Lysine, permease component 2 (characterized)	34%	97%	117.9	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-glutamate catabolism	gluD	lo	GluD aka CGL1953, component of Glutamate porter (characterized)	34%	83%	116.3	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-asparagine catabolism	aapM	lo	AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	30%	64%	115.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-aspartate catabolism	aapM	lo	AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	30%	64%	115.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-glutamate catabolism	aapM	lo	AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	30%	64%	115.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-histidine catabolism	aapM	lo	AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	30%	64%	115.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-leucine catabolism	aapM	lo	AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	30%	64%	115.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-proline catabolism	aapM	lo	AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	30%	64%	115.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
D-alanine catabolism	Pf6N2E2_5404	lo	ABC transporter for D-Alanine, permease component 1 (characterized)	34%	56%	114.8	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-arginine catabolism	artM	lo	AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized)	32%	95%	114.8	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-histidine catabolism	hisM	lo	Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)	35%	96%	113.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-asparagine catabolism	peb1D	lo	Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)	30%	90%	112.5	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-aspartate catabolism	peb1D	lo	Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)	30%	90%	112.5	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-citrulline catabolism	AO353_03045	lo	ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)	33%	91%	112.1	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-arginine catabolism	artQ	lo	ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)	33%	92%	110.9	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-citrulline catabolism	AO353_03050	lo	ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)	33%	92%	110.9	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-citrulline catabolism	PS417_17595	lo	ABC transporter permease subunit; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine transport system permease protein (characterized, see rationale)	34%	91%	110.9	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-histidine catabolism	BPHYT_RS24005	lo	Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)	31%	83%	110.5	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-asparagine catabolism	aatQ	lo	ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized)	31%	86%	109.8	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-aspartate catabolism	aatQ	lo	ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized)	31%	86%	109.8	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-glutamate catabolism	gltJ	lo	ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized)	31%	86%	109.8	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-citrulline catabolism	PS417_17600	lo	ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale)	33%	87%	103.6	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-histidine catabolism	hisQ	lo	Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)	32%	91%	103.2	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-histidine catabolism	BPHYT_RS24010	lo	Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)	34%	92%	102.1	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-asparagine catabolism	natG	lo	NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)	32%	73%	87.4	Basic amino acid uptake transporter, BgtAB	33%	254.6
L-aspartate catabolism	natG	lo	NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)	32%	73%	87.4	Basic amino acid uptake transporter, BgtAB	33%	254.6

Sequence Analysis Tools

View WP_012412537.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKKKKAWLLTILVVAVVGISIITGHSNSLKAVSSLGKDTLTMITSPDYPPYEFYDTKGGD
RQIVGFDIDIAKTLAEKLGFKLQIMESDFNGLIPALQANRADFVMAGMTPTPERQKNIDF
SIIYYEAKDTIVAPKGSNLKQPQDLLGKKLGVQLGTIQEQNARKISQKVAGIQLKQLNKV
PEVVQEIKSGRIDAAIVEDTVAKGFAQANPDLEFNTIPSEEASGSAIAFPKGSSFVEPFN
KVLQQMKDDGTLAKLVTKWFSQNTAANSVSSTPAKGGLNLDFTRILPDIPFILRGIPLTL
LFTLLSVTLGLIWGTILSLLKILGIKPLTWVANAYTSVFRGTPLLLQLALVYYATPQLTG
YDISALEAGVLTFTLNSGAYMSETIRGGIQAVDKGQSEAAMSMGVPYWLMMWDVILPQAL
KNILPALVNETIGLLKDSALVSTIGVVEILRSAQIVGANKYIYFEPLLFAGLIYYVLVMG
MTLGASALEKRLRESE

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.