Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_012466585.1 CLIM_RS08420 triose-phosphate isomerase
Query= SwissProt::Q8XKU1 (248 letters) >NCBI__GCF_000020465.1:WP_012466585.1 Length = 251 Score = 239 bits (609), Expect = 5e-68 Identities = 129/247 (52%), Positives = 161/247 (65%), Gaps = 4/247 (1%) Query: 2 RTPIIAGNWKMHYTIDEAVKLVEELKPLVKD--AKCEVVVCPTFVCLDAVKKAVEGTNIK 59 RT I+AGNWKM+ TI E+V+L + + + CE + PT L K + ++ Sbjct: 3 RTNIVAGNWKMNLTIAESVELASAVIAELGSGFSGCEAGIAPTCPALFETGKLLASGSLF 62 Query: 60 VGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHN 119 + AQN H+E GAFTGE++ RM+ YVIIGHSERR+ F ETDE N+KV A Sbjct: 63 LAAQNCHYENDGAFTGEVSARMILGAGCTYVIIGHSERRQLFGETDEIVNRKVSKALQEG 122 Query: 120 LTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATS 179 L ILC GETLE+RE G T DV+ Q+ A L G+ +VIAYEP+WAIGTGKTA+S Sbjct: 123 LRVILCVGETLEEREGGITGDVVTRQVKAGLAGIAG--IGDLVIAYEPVWAIGTGKTASS 180 Query: 180 DQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVA 239 +QA E A IR V+E++G E AD +RIQYGGSVKP+ AE A DIDG L+GGASL A Sbjct: 181 EQAQEVHALIRKTVSELYGAEAADGLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLNA 240 Query: 240 ADFAQIV 246 ADFA IV Sbjct: 241 ADFAAIV 247 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 251 Length adjustment: 24 Effective length of query: 224 Effective length of database: 227 Effective search space: 50848 Effective search space used: 50848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_012466585.1 CLIM_RS08420 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.9656.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-64 204.0 0.8 1.7e-64 203.8 0.8 1.0 1 lcl|NCBI__GCF_000020465.1:WP_012466585.1 CLIM_RS08420 triose-phosphate is Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020465.1:WP_012466585.1 CLIM_RS08420 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 203.8 0.8 1.7e-64 1.7e-64 1 227 [. 6 240 .. 6 241 .. 0.92 Alignments for each domain: == domain 1 score: 203.8 bits; conditional E-value: 1.7e-64 TIGR00419 1 lviinfKlnesvgkvelevaklaeev.aseagvevavappfvdldvvkdeve.seiqvaAqnvdavksG 67 +v +n+K+n ++ + ++ + + +e+ ++ +g+e ++ap l + + + +aAqn++ + G lcl|NCBI__GCF_000020465.1:WP_012466585.1 6 IVAGNWKMNLTIAESVELASAVIAELgSGFSGCEAGIAPTCPALFETGKLLAsGSLFLAAQNCHYENDG 74 699********99887777777777626789********9988877666665489************** PP TIGR00419 68 aftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartin 136 aftGe+sA m+ +G+ +v+igHsErR l+ e+de+++ kv+++ + gl++++Cvgetleere + t + lcl|NCBI__GCF_000020465.1:WP_012466585.1 75 AFTGEVSARMILGAGCTYVIIGHSERRQLFGETDEIVNRKVSKALQEGLRVILCVGETLEEREGGITGD 143 ********************************************************************* PP TIGR00419 137 nvattaaa.aA....lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkk.vskevaesvrvlyGa 199 +v+++ +a A + + v+A+EPv++iGtGk++s +a++v++ +r +++ +e a+ r++yG+ lcl|NCBI__GCF_000020465.1:WP_012466585.1 144 VVTRQVKAgLAgiagIGDLVIAYEPVWAIGTGKTASSEQAQEVHALIRKTVSElYGAEAADGLRIQYGG 212 **99987732355579999*****************************999997889************ PP TIGR00419 200 svtaaedaelaaqldvdGvLlasavlka 227 sv+ +++ael+a +d+dG L+++a+l a lcl|NCBI__GCF_000020465.1:WP_012466585.1 213 SVKPSNAAELFAMPDIDGGLIGGASLNA 240 *************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (251 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.44 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory