Align galactose-1-phosphate uridylyltransferase (EC 2.7.7.12) (characterized)
to candidate WP_012468494.1 GLOV_RS01960 galactose-1-phosphate uridylyltransferase
Query= metacyc::MONOMER-15710 (344 letters) >NCBI__GCF_000020385.1:WP_012468494.1 Length = 341 Score = 244 bits (622), Expect = 3e-69 Identities = 135/349 (38%), Positives = 197/349 (56%), Gaps = 27/349 (7%) Query: 11 ELRKDSVTNRWVIFSPARAKRPSDFKSKSPAPSSTDSPQTCPFCIGQEHHCAPEIFRFPP 70 ELR D + WVI + R +RP DF+S+ P P S CPFC G E PEIF P Sbjct: 3 ELRWDPLKLHWVIIATERGRRPRDFQSE-PEPLPVTS---CPFCYGNEDKTPPEIFAIRP 58 Query: 71 QN----PDWKVRVIQNLYPALSRDKDLDSSTSLSSGSLLWGCLLDGYGFHDVIIESPVHS 126 P+WKVRVI N YPAL + +L++ +++G G H+VIIE+P H Sbjct: 59 SGMPNTPNWKVRVIPNKYPALRIEGELENRGHGPYD------VMNGIGAHEVIIETPDHD 112 Query: 127 VHLSDLTPEDVAQVLFAYKKRILQLASDDSIKYVQVFKNHGASAGASMTHPHSQMVGLPV 186 ++DL P ++ VL ++ R+L L D +Y+ +FKNHGA AGAS+ H HSQ++ +P+ Sbjct: 113 KSMADLAPAELTDVLVTWRTRLLDLRRDFRFRYMILFKNHGARAGASLAHSHSQLIAVPM 172 Query: 187 IPPSVTTRLDSMKQYFNETGKCSICHVPTKDL-----LVDESVHFISVVPYAASFPFELW 241 +PP TT L + ++ +C C + T +L +V E +F+++ PYAASFPFEL Sbjct: 173 LPPVATTELKVCRTHYANKERCLFCDLITFELEQGVRVVREFSNFVTLAPYAASFPFELR 232 Query: 242 IVPRDHVSHFHELDQEKAVDLGGLLKVTLIKMSLQLNKPPFNFMIHTSP-------LQAS 294 + P+ H F ++ + +L LK L+++ L L P+NF++HT P A Sbjct: 233 LYPKRHSHDFALMNDAQLAELAVALKDMLMRVKLVLKDAPYNFILHTCPPMHKRPGKPAM 292 Query: 295 DSDLAYS-HWFFQIVPHLSGVGGFELGTGCYINPVFPEDAAKVMREVNI 342 + L Y HW ++VP L+ + GFE GTG +INP PEDAA +RE + Sbjct: 293 WTSLEYDYHWHIELVPRLTSIAGFEWGTGFFINPTSPEDAALFLREAEV 341 Lambda K H 0.320 0.135 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 341 Length adjustment: 29 Effective length of query: 315 Effective length of database: 312 Effective search space: 98280 Effective search space used: 98280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory