Protein WP_012468536.1 in Geobacter lovleyi SZ
Annotation: NCBI__GCF_000020385.1:WP_012468536.1
Length: 350 amino acids
Source: GCF_000020385.1 in NCBI
Candidate for 20 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-arabinose catabolism | xacJ | lo | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 42% | 57% | 161.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-cellobiose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 86% | 156.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-glucose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 86% | 156.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
lactose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 86% | 156.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-maltose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 86% | 156.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
sucrose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 86% | 156.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
trehalose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 86% | 156.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 86% | 156.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 33% | 87% | 152.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 33% | 79% | 152.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-mannitol catabolism | mtlK | lo | ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) | 31% | 84% | 152.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) | 37% | 60% | 151.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-maltose catabolism | malK | lo | Maltose-transporting ATPase (EC 3.6.3.19) (characterized) | 35% | 69% | 149.1 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-cellobiose catabolism | msiK | lo | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 37% | 60% | 143.3 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 31% | 86% | 142.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
trehalose catabolism | thuK | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 31% | 86% | 142.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
L-arabinose catabolism | xacK | lo | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 33% | 70% | 138.3 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-maltose catabolism | musK | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 35% | 61% | 136.3 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
trehalose catabolism | malK | lo | MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) | 31% | 77% | 134 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
D-maltose catabolism | malK_Sm | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 30% | 79% | 133.3 | ABC-type molybdate transporter (EC 7.3.2.5) | 35% | 183.7 |
Sequence Analysis Tools
View WP_012468536.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MELQLQLRKQQGDFALELDLKVSGERIGIFGPSGSGKSTLVNLLAGLARPDAGQILLDGQ
PLFDSSNRINLLPHRRRIALVFQQHGLFPHLTVRKNLLYGYQRCPAAERRIELAEVAEVL
EITDLMGQMPDTLSGGQSQRVALGRAILASPRLLLMDEPLSALDDDLRYRIIPYLNLVSE
RFRIPFVFISHSLVEMRLMADQVAVLEKGQLAGVVAPEELARQRMGQSASGYINLLELGM
PEEQEGLLAFPWAGQELLLSGGAGTEPGTFELSSRDIILCKRHPDAISARNLLPCMVRSL
FESGKKTGIELDCNGSSLVAEVVPAAAQELQITPGSTVWAAIKASAFRRL
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory