Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_012468795.1 GLOV_RS03485 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >NCBI__GCF_000020385.1:WP_012468795.1 Length = 363 Score = 248 bits (633), Expect = 1e-70 Identities = 124/248 (50%), Positives = 178/248 (71%), Gaps = 13/248 (5%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 + V L K YG VLK +SL A G+VISIIG SG+GKSTFLRC+NLLEQP G I ++ Sbjct: 2 IRVAHLSKTYGEVTVLKDISLSVAKGEVISIIGPSGTGKSTFLRCLNLLEQPSGGSIAVD 61 Query: 64 NEELKLVANKDGALKAADPKQ-LQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMS 122 +L D K + R+R R++MVFQ FNL+SH+TA+EN+ PV +LG++ Sbjct: 62 GIDL------------LDKKSDIPRIRQRMNMVFQSFNLFSHLTALENLTIGPVRLLGIN 109 Query: 123 KTEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDP 182 K EA +KA L VG+A + D++P +SGG++QRVAIAR LAM PE++LFDEPTSALDP Sbjct: 110 KQEAEQKALEILKLVGLAEKADSFPDELSGGQKQRVAIARCLAMNPEIILFDEPTSALDP 169 Query: 183 ELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQS 242 +V +VL V++ LA++G TM++VTHEM FAR+VS++++++ +G++ E G P+++ NPQ Sbjct: 170 TMVSEVLAVIRRLAKDGMTMLIVTHEMDFARDVSSRVLYMDEGLIYEEGTPQQIFENPQK 229 Query: 243 ERLQQFLS 250 E+ + F++ Sbjct: 230 EKTRAFIN 237 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 363 Length adjustment: 27 Effective length of query: 227 Effective length of database: 336 Effective search space: 76272 Effective search space used: 76272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory