Align Putative UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_012469211.1 GLOV_RS05615 NAD-dependent epimerase/dehydratase family protein
Query= curated2:Q57664 (305 letters) >NCBI__GCF_000020385.1:WP_012469211.1 Length = 312 Score = 142 bits (359), Expect = 8e-39 Identities = 102/311 (32%), Positives = 159/311 (51%), Gaps = 23/311 (7%) Query: 2 ILVTGGAGFIGSHIVDKLIENNYDVIILDNLTTGNKNNI-----NPKAEFVNADIRDKDL 56 ILVTGGAGF+GSH+ ++L+ DVI LDNL TG+K+NI N + E + DI + L Sbjct: 3 ILVTGGAGFLGSHLCERLLNEGNDVICLDNLFTGSKDNIIHLMDNHRFELIRHDIVEPIL 62 Query: 57 DEKINFKDVEVVIHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIDKIVFASSG 116 E V+ + + A + + NPV +V+G IN+L M ++ + + +S Sbjct: 63 LE------VDRIYNLACPASPVHYQYNPVKTVKTSVMGMINMLGMAKR--VKARILQAST 114 Query: 117 GAVYGEPNYLPVDENH-----PINPLSPYGLSKYVGEEYIKLYNRLYGIEYAILRYSNVY 171 VYG+P P E + PI S Y K V E + Y+R ++ I+R N Y Sbjct: 115 SEVYGDPQVHPQKEEYWGNVNPIGIRSCYDEGKRVAETLMMDYHRQNKVDIRIIRIFNTY 174 Query: 172 GERQDPKGEAGVISIFIDKMLKNQSPIIFGDGNQTRDFVYVGDVAKANLMALNWKNEI-- 229 G R + + V+S F+ + LKN+ +FG+G QTR F YV D+ + + + + Sbjct: 175 GPRM-AENDGRVVSNFMLQALKNEDITVFGEGRQTRSFCYVSDLIDGMIRMMENEQDFIG 233 Query: 230 -VNIGTGKETSVNELFDIIKHEIGFRGEAIYDKPREGEVYRIYLDIKKA-ESLGWKPEID 287 VN+G E ++ E + I G + + IY + + + DI A E LGW+P ID Sbjct: 234 PVNLGNPVENTILEFAEKIITITGSKSKIIYKPLPQDDPKQRRPDITLAQEKLGWQPSID 293 Query: 288 LKEGIKRVVNW 298 L+ G+K ++ Sbjct: 294 LETGLKATADY 304 Lambda K H 0.317 0.140 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 312 Length adjustment: 27 Effective length of query: 278 Effective length of database: 285 Effective search space: 79230 Effective search space used: 79230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory