Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_012469333.1 GLOV_RS06220 ROK family protein
Query= curated2:Q9KCZ4 (330 letters) >NCBI__GCF_000020385.1:WP_012469333.1 Length = 303 Score = 190 bits (483), Expect = 3e-53 Identities = 111/311 (35%), Positives = 167/311 (53%), Gaps = 22/311 (7%) Query: 6 YVGVDVGGTTIKMAFLTTAGEIVDKWEIPTNKQDGGALITTNIADALDKRLSGHHKSKSD 65 Y+G+D+GGT ++ A + GE++ ++ + + G + + +D+ + S Sbjct: 8 YIGIDIGGTNLRGALVRPGGEVMARFRSKSAIEGGADSFLMRLTEEIDRLIVEARVSGLQ 67 Query: 66 LIGIGLGAPGFIEMDTGFIYHAVNIG-WRDFPLKDKLEEETKLPVIVDNDANIAALGEMW 124 + G+G+G PG I D G I+ +VN+ L LE+ +PVI NDAN+ ALGE W Sbjct: 68 VSGVGVGVPGLIGSD-GVIHSSVNLRPLEGMNLSRSLEDRLGIPVISANDANLIALGEAW 126 Query: 125 KGAGDGAKNMLLITLGTGVGGGIVANGNILHGVNGMAGEIGHITVIPEGGAPCNCGKTGC 184 GAG G +++++IT+GTG+G G++ +G + G G A E GH+TV PE G PC CG GC Sbjct: 127 AGAGQGMRSLMVITIGTGLGSGLILDGKLWTGAGGFAAEFGHLTVEPE-GIPCPCGNRGC 185 Query: 185 LETVASATGIARIATEGVTEHKESQLALDYDKHGVLTAKDVFSAADASDAFALSVVDHIA 244 LE SA ++R G T + LA + D DA AF + + Sbjct: 186 LEQYVSAAALSRYG-RGKTPEVLALLAGEGD-------------TDACAAF-----ETLG 226 Query: 245 YYLGFAIANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFEAYALPRVADGAEFRIATLG 304 Y+LG A+A L N LN E ++IGGGVS + D + Q + A PR+ + A LG Sbjct: 227 YWLGTALAGLVNTLNLEGVIIGGGVSASFDLFAPAVLQTLKQRAFPRMVAALKLCQAALG 286 Query: 305 NDAGVIGGGWL 315 +DAG++GG L Sbjct: 287 DDAGLVGGALL 297 Lambda K H 0.316 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 303 Length adjustment: 27 Effective length of query: 303 Effective length of database: 276 Effective search space: 83628 Effective search space used: 83628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory