Align NAD-dependent succinate semialdehyde dehydrogenase (EC 1.2.1.24) (characterized)
to candidate WP_012469395.1 GLOV_RS06525 NAD(P)-dependent oxidoreductase
Query= metacyc::MONOMER-15565 (287 letters) >NCBI__GCF_000020385.1:WP_012469395.1 Length = 288 Score = 175 bits (443), Expect = 1e-48 Identities = 94/287 (32%), Positives = 160/287 (55%) Query: 1 MEEIGFLGIGIMGKAMAVNLLRHGFKVTVWNRTLSRCDELVQHGASVGETPAEVIKKCKY 60 + +IGF+G+G +G+ MA NL+R G+ + V++ S+ DELV GA+ ET AE + + Sbjct: 2 LRKIGFIGLGTVGRHMAANLVRGGYDLAVFDTDPSKMDELVALGATGAETAAEAARGREL 61 Query: 61 TIAMLSDPAAALSVVFDKHGALEHICAGKGYIDMSTVDADTSSQISQAITSKGGSFLEAP 120 I+++S+ + + G L I G + DM T +T+ Q+++ K +L+AP Sbjct: 62 VISIVSEGDEQGPLFCGETGILAGIEPGTIFADMGTTSLETTLQMAEETAKKRCFYLDAP 121 Query: 121 VSGSKKPAEDGQLVILAAGDKDLYDQVVPAFDVLGKKSFFLGKIGNGAKMKLVVNMIMGS 180 V G+K A G L I+ GD + + F + G + +G+IG+ KMK +VNM+ G+ Sbjct: 122 VWGNKDHAASGLLTIIVGGDPGIIGKCREPFSIFGLNTITVGEIGDATKMKFIVNMVQGT 181 Query: 181 MMNAFSEGIVLADKSGLDPHTLLDVLDLGAIANPMFKMKGPAMIKNSYPPAFPLKHQQKD 240 ++ +EG+V +K G +L+VLD +A+P+F +KG AM +N + + +K+ Sbjct: 182 LVQVLAEGLVFGEKMGFSADKILEVLDTRGVASPIFHLKGRAMSRNEFTRSLAMKYVNDG 241 Query: 241 MRLALALGDENAVPMPVAAAANEAFKKARSLGLGDLDFSAVFETLSK 287 M L + + +P A AA++ ++K G G+ DFSAV + L K Sbjct: 242 MHLVMNAARLVGLHLPAAEAASKMYEKGVEAGYGEEDFSAVIKVLRK 288 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 288 Length adjustment: 26 Effective length of query: 261 Effective length of database: 262 Effective search space: 68382 Effective search space used: 68382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory