Align Propionyl-CoA carboxylase carboxyl transferase subunit (EC 6.4.1.3) (characterized)
to candidate WP_012471292.1 GLOV_RS16145 acetyl-CoA carboxylase carboxyltransferase subunit
Query= reanno::PS:Dsui_0517 (510 letters) >NCBI__GCF_000020385.1:WP_012471292.1 Length = 574 Score = 286 bits (731), Expect = 2e-81 Identities = 182/540 (33%), Positives = 276/540 (51%), Gaps = 73/540 (13%) Query: 2 HDIIHELEKKREAARLGGGQKRIDSQHKKGKLTARERLELLLDPDS---FEEWDMFKEHR 58 HD+I K A+ I+ QH K ++T ER+++L + + F+ W Sbjct: 43 HDLIQRPIKSVSIAQ-------IEKQHFKKRMTVWERIKVLTEKEPNVLFQNWG------ 89 Query: 59 CTDFGMAETKN-PGDGVVTGYGTINGRLVFVFSQDFTVFGGSLSETHAEKICKVMDHAMK 117 KN G +VTG +NGR V ++ DFTV GS+ T+ K+ + A + Sbjct: 90 ---------KNLDGASLVTGILNVNGRDVALYGHDFTVRAGSIDATNGRKLALLFQMAGE 140 Query: 118 VGAPVIGLNDSGGARIQEGVASLGGYADVFQRNVMASGVIPQISMIMGPCAGGAVYSPAM 177 G PVIG+NDS GA + GV L GYA+ F SGV+P I + G AGG Y P Sbjct: 141 KGIPVIGMNDSAGAFVPAGVGGLDGYAEAFTALRKISGVVPSIMCMFGFNAGGGSYLPRQ 200 Query: 178 TDFIFMVKDSSYMFVTGPEVVKTVTHEEVTAEELGGAVTHTTKSGVADLAFENDVEALNY 237 F+ D+ + +TGP VVK+V E+VT E+LGG H SGVADL E++V AL Sbjct: 201 GSFVIQPNDT-FFGLTGPGVVKSVLGEDVTPEDLGGPKVHGA-SGVADLTVEDEVGALRA 258 Query: 238 LRRLVNFLPANNREKPPVQKTNDPAERLDFSLDTLV------PDNANKPYDMKELIIKMV 291 +L++++P NN P ++T+DP +R + ++TL+ P N P+D+ +I ++ Sbjct: 259 SLQLLSYVPDNNSVAPRFRQTSDPLDRKTWEINTLLKKAFNSPTGFNTPFDVSIMIQQIC 318 Query: 292 DDCDFFEIQPDYAKNIITGFARMDGHPVGIVANQPLVLAGCLDIKSSIKAARFVRFCDAF 351 D D+FE+QPD A+ +T F R+ G+ VG VAN V +G + + S+ K ARF RFC+ + Sbjct: 319 DHGDYFEMQPDRAREAVTAFGRLGGNVVGFVANNSAVASGQISVDSAYKIARFNRFCNIY 378 Query: 352 NIPVVTLVDVPGFMPGTSQEYGGIIKHGAKLLYAYAECTVPKVTLITRKAYGGAYDVMSS 411 NIP++ + D GF+PG QE GI++ G +L + + P++ LI R AYGGAY ++ Sbjct: 379 NIPLIFMEDTTGFLPGREQESRGIVQAGRAMLDSIVDIRTPRILLIIRNAYGGAYASYNN 438 Query: 412 KHLRGDVNLAWPSAEIAVMGPKGAVEIIFREE-------------------------KND 446 D+ LA P+ +AVMGP G E ++++E Sbjct: 439 YPTGADLVLALPTTRLAVMGPAGK-EFVYKDELRKLRGAVKDKVKSGVQERVAAGMDAGQ 497 Query: 447 PAKLAEREA-------------EYKAKFANPFVAGARGFIDDVIMPNETRKRICRSLAML 493 K AE++ Y+ + NP A G I ++MP + RK + ++ L Sbjct: 498 ATKDAEKDVADWLRIEEAALNLRYEKELMNPKEGLALGSISSLVMPTDLRKVLGENMNFL 557 Lambda K H 0.320 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 769 Number of extensions: 45 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 510 Length of database: 574 Length adjustment: 35 Effective length of query: 475 Effective length of database: 539 Effective search space: 256025 Effective search space used: 256025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory