Align glucokinase (EC 2.7.1.2) (characterized)
to candidate WP_012475909.1 CPHAMN1_RS12660 sugar kinase
Query= reanno::SB2B:6938110 (299 letters) >NCBI__GCF_000020545.1:WP_012475909.1 Length = 307 Score = 184 bits (468), Expect = 2e-51 Identities = 119/310 (38%), Positives = 168/310 (54%), Gaps = 26/310 (8%) Query: 5 GVDLGGTKIELVALGEDGSELFRKRIATP-REYQGTL-----NAVVTLVNEAEATLGTQG 58 G+DLGGTKIE L E+ L R RI T RE G + N + + +E L + Sbjct: 7 GIDLGGTKIEGCVLDENMRSLVRLRIPTEAREGYGHILSRVDNLLRMMADELRCELPSH- 65 Query: 59 SLGIGIPGVISPYTGLVKNANSTWINGHPLDRDLGALLNREVRVANDANCFAVSEAVDGA 118 +GIG PG + + L++N+N+ +NG PL DL L +VR+ NDANCFA++E++ G Sbjct: 66 -IGIGTPGRLDRRSSLLRNSNTGCLNGRPLLCDLEETLQIKVRLDNDANCFALAESLLGT 124 Query: 119 AAG-----KRVVFGAILGTGCGAGLAFDGRVHEGGNGIGGEWGHNPLPWMRPDEFNTTE- 172 V FG ILGTG G G+ +GRVH G +GI GEWGHN L F E Sbjct: 125 GRTVMQREDAVAFGVILGTGVGGGIVCNGRVHVGAHGIAGEWGHNRL-------FENGEA 177 Query: 173 CFCGNKDCIETFVSGTGFVRDFRNSGGTAQNGAEIMSLVDAGDELANLVFDRYLDRLARS 232 C+CG K C+ET +SG R + G + + ++ + D LA R L R Sbjct: 178 CYCGRKGCVETVLSGPALERYYARRSGGVRKSLQEIAQSEESDPLAGETIWRLLSGFGRG 237 Query: 233 LAHVINMLDPDAIVLGGGMSNVQAIYARLPAI---LPKYVVGRECRTPVVQNLYGCSSGV 289 +A VIN+LDPD +++GGG+ NV+A+Y+ PA + K++ VV+ G S+GV Sbjct: 238 IAGVINILDPDILIIGGGVGNVEALYS--PAARKEIEKHLFNESLDITVVRPELGDSAGV 295 Query: 290 RGAAWLWEKR 299 GAA L ++ Sbjct: 296 FGAALLTARK 305 Lambda K H 0.320 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 307 Length adjustment: 27 Effective length of query: 272 Effective length of database: 280 Effective search space: 76160 Effective search space used: 76160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory