Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_012501526.1 CPAR_RS01385 epimerase
Query= BRENDA::O73960 (318 letters) >NCBI__GCF_000020505.1:WP_012501526.1 Length = 333 Score = 77.4 bits (189), Expect = 4e-19 Identities = 70/227 (30%), Positives = 106/227 (46%), Gaps = 21/227 (9%) Query: 3 VLVTGGAGFIGSHLVDRLMEEGYKVRVLDDLSAGSLKNIEGWLGNENFEFIKGDMRDVEI 62 +LVTG GFIGS +VDRL+ EG +VRVL + S G E ++ D E Sbjct: 5 ILVTGSTGFIGSRMVDRLVGEGCRVRVLLRPESASFSAAS---GRNGVETVRAAYDDAEA 61 Query: 63 VSKAVKDVDAVFHLAANPEVRIGSQSPELLYETNVLITYNLLNAVR--NSGVKYLVFTSS 120 + +AV VD++ HLA + + NV+ NLL AV+ N G++ + SS Sbjct: 62 LGRAVSGVDSIIHLAGLTK----AADEAGFISGNVMPVENLLGAVQRHNPGLRRFLLVSS 117 Query: 121 STVYGDAKVIPTP---EDYAPLEPISVYGAAKLAAEALISGYAHTFDFRALIIRLANIIG 177 G A+ P+P E +P P+S YG +KL E + H I+R + G Sbjct: 118 LAAAGPAQ-SPSPGVRESDSP-APVSAYGRSKLLGEE--AALRHAGAVPLTIVRPPAVYG 173 Query: 178 KRSNHGVIYDFINKLKANPNELEILGDGT-QRKSYLHISDTIDGIMK 223 + ++ F K L G G QR S +H+ D ++G+++ Sbjct: 174 P-GDRDILEVFAMMKK---GYLLSAGSGVRQRFSMIHVDDLVEGMLR 216 Lambda K H 0.318 0.138 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 333 Length adjustment: 28 Effective length of query: 290 Effective length of database: 305 Effective search space: 88450 Effective search space used: 88450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory