Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_012502954.1 CPAR_RS08750 dTDP-glucose 4,6-dehydratase
Query= BRENDA::F2NQX6 (314 letters) >NCBI__GCF_000020505.1:WP_012502954.1 Length = 349 Score = 134 bits (337), Expect = 3e-36 Identities = 103/331 (31%), Positives = 161/331 (48%), Gaps = 31/331 (9%) Query: 1 MRVLVTGGAGFIGSHLV-HALHQ-KGIPVAVLDDLS-TGKRAHIP-----PDVPLYQTDI 52 M +L+TGGAGFIGSH+V H L++ V LD L+ G A++ P+ + DI Sbjct: 1 MHILITGGAGFIGSHVVRHFLNRYPDYTVTNLDKLTYAGNLANLKDVESNPNYRFVKGDI 60 Query: 53 RDLNAVLHAFQDFQPTHVAHQAAQASVKHSVQNPCKDAEINLLGGLNILEAMRATG---- 108 D +L F + + V H AA++ V S+++P + N+LG +N+L A RAT Sbjct: 61 ADGPFLLDLFNEQRFDAVVHLAAESHVDRSIESPVEFVIANVLGTVNLLNAARATWGGKF 120 Query: 109 TQKIVFASTGGAIYGEVPEGRRAPETWPPKPKSPYAASKAAFEHYLEVYRQTHGLTYTTL 168 K+ + + +YG + G ET P P SPY+ASKA+ +H++ + T+GL Sbjct: 121 DGKLFYHVSTDEVYGSLGSGGMFSETTPYDPHSPYSASKASSDHFVRAFHDTYGLPVVIS 180 Query: 169 RYANVYGPRQDPHGEAGVVAIFTNRLLHAQPVTLYARKEPGDPGCIRDYIHVEDVTRANL 228 +N YG Q P ++ +F N + +P+ +Y G +RD++ V D RA Sbjct: 181 NCSNNYGSHQFPE---KLIPLFINNIRLEKPLPVY-----GAGLNVRDWLWVVDHARAID 232 Query: 229 LALETNLEG-TYNVSTGQGRTTEDVLYTIARAL---------GTTPRVTYAPPRDGDLEV 278 G TYN+ T D++ + R + + +TY R G Sbjct: 233 EIFHRGTVGETYNIGGHNEWTNIDLIRLLCRIMDRKLGRDDGSSETLITYVTDRAGHDLR 292 Query: 279 SVLDPTQLQAH-GWRPQVPFEEGIRRTVAWF 308 +D ++LQ GW P V FEEG+ +TV W+ Sbjct: 293 YAIDASKLQRELGWVPSVTFEEGLEKTVDWY 323 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 349 Length adjustment: 28 Effective length of query: 286 Effective length of database: 321 Effective search space: 91806 Effective search space used: 91806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory