Align Methylmalonyl-CoA epimerase; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 (characterized)
to candidate WP_012505459.1 PAES_RS04405 methylmalonyl-CoA epimerase
Query= SwissProt::O58010 (136 letters) >NCBI__GCF_000020625.1:WP_012505459.1 Length = 134 Score = 105 bits (263), Expect = 2e-28 Identities = 56/134 (41%), Positives = 83/134 (61%), Gaps = 4/134 (2%) Query: 4 MFKRIDHVGIAVKNLEEAIKIWEGL-GFKVEE--IEEVPDQKVKVAVIKVGENRIELLEA 60 M IDH+ IAV +L+ AI+ + L G E IE+VP +KV+VA I +G ++IELLE Sbjct: 1 MISNIDHIAIAVNDLDSAIQQFSALTGIDPESVHIEQVPSEKVRVAFIALGSSKIELLEP 60 Query: 61 TTEDSPIAKFIEKRGEGIHHLAIRVENIESKLEELKQKGYKLIDEKPRVGAGGAKIAFIH 120 PIA F+EKRGEG+HH+A+ N++ +LE +++ + P GAG KI F + Sbjct: 61 LDRSGPIATFLEKRGEGLHHIALETANLDKELERTQKENLHPL-SSPSTGAGKKKIVFFN 119 Query: 121 PKSVTGVLLELCER 134 PK + VL+E ++ Sbjct: 120 PKDTSRVLIEFVQK 133 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 68 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 136 Length of database: 134 Length adjustment: 15 Effective length of query: 121 Effective length of database: 119 Effective search space: 14399 Effective search space used: 14399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 42 (20.8 bits)
Align candidate WP_012505459.1 PAES_RS04405 (methylmalonyl-CoA epimerase)
to HMM TIGR03081 (mce: methylmalonyl-CoA epimerase (EC 5.1.99.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03081.hmm # target sequence database: /tmp/gapView.6814.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03081 [M=129] Accession: TIGR03081 Description: metmalonyl_epim: methylmalonyl-CoA epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-39 120.1 0.0 5.2e-39 119.9 0.0 1.0 1 lcl|NCBI__GCF_000020625.1:WP_012505459.1 PAES_RS04405 methylmalonyl-CoA e Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020625.1:WP_012505459.1 PAES_RS04405 methylmalonyl-CoA epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 119.9 0.0 5.2e-39 5.2e-39 2 129 .] 5 132 .. 4 132 .. 0.96 Alignments for each domain: == domain 1 score: 119.9 bits; conditional E-value: 5.2e-39 TIGR03081 2 ldhvaiavkdleeaaklyrdvlGa..kvseeeelpeqgvkvvflelgetklellepleedspiakflek 68 +dh+aiav+dl++a++ + ++ G+ + + e++p ++v+v+f++lg +k+ellepl++ +pia flek lcl|NCBI__GCF_000020625.1:WP_012505459.1 5 IDHIAIAVNDLDSAIQQFSALTGIdpESVHIEQVPSEKVRVAFIALGSSKIELLEPLDRSGPIATFLEK 73 9**********************9555779*************************************** PP TIGR03081 69 kkgeGlhhialevddieaaletlkekgvrlldeepriGahGkkvaFlhPkdtgGvLielee 129 + geGlhhiale+ ++++ le ++++++ l+ +p +Ga+ kk++F+ Pkdt+ vLie+++ lcl|NCBI__GCF_000020625.1:WP_012505459.1 74 R-GEGLHHIALETANLDKELERTQKENLHPLS-SPSTGAGKKKIVFFNPKDTSRVLIEFVQ 132 *.*****************************7.699**********************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (129 nodes) Target sequences: 1 (134 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.02 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory