Align L-lactate dehydrogenase (EC 1.1.1.27) (characterized)
to candidate WP_012506154.1 PAES_RS08010 malate dehydrogenase
Query= BRENDA::Q9GT92 (321 letters) >NCBI__GCF_000020625.1:WP_012506154.1 Length = 310 Score = 261 bits (666), Expect = 2e-74 Identities = 134/304 (44%), Positives = 199/304 (65%), Gaps = 6/304 (1%) Query: 6 KIAVIGSGQIGGNIAYIVGKDNLA-DVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGT 64 KI VIG+G +G A+ + + LA +VVL DI EGIPQGKALD+ S + SK+ GT Sbjct: 2 KITVIGAGHVGATAAHRIAEMQLAKEVVLLDIVEGIPQGKALDMYESGPIGLFDSKIYGT 61 Query: 65 NDYADISGSDVVIITASIPGRPKDDRSELLFGNARILDSVAEGVKKYCPNAFVICITNPL 124 NDY D + SD+++ITA + +P R +LL NA I+ V + + +Y N +I ++NPL Sbjct: 62 NDYQDTADSDIILITAGMARKPGMSREDLLLKNATIVKEVTDRIMQYSSNPIIIMVSNPL 121 Query: 125 DVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPV 184 D+M S LP +V GMAGVLDS+RFR+FIA+ V+ D++A V+GGHGD MVPV Sbjct: 122 DIMTYVSYVRSKLPKERVIGMAGVLDSARFRSFIAEELNVSMKDINAFVLGGHGDSMVPV 181 Query: 185 TSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMA 244 ++ G+PL+ L++QE+ID +V TR E+ + LK G+AY+APAA+AV+M Sbjct: 182 VKYTNIAGIPLTE-----LLSQEKIDSLVDRTRKGGAEIVNYLKDGSAYYAPAASAVEMI 236 Query: 245 EAYLKDRKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLKQKLLGESIN 304 +A + DRK ++PCS + YG+ +++GVP IGKNG+E++LE++L + + L +S + Sbjct: 237 DAIVHDRKRILPCSTLVTGQYGMDNVFIGVPVKIGKNGIEEVLEINLDTAELEALRQSAS 296 Query: 305 EVNT 308 V + Sbjct: 297 IVES 300 Lambda K H 0.319 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 310 Length adjustment: 27 Effective length of query: 294 Effective length of database: 283 Effective search space: 83202 Effective search space used: 83202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory