Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_012506807.1 PAES_RS11325 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000020625.1:WP_012506807.1 Length = 397 Score = 456 bits (1172), Expect = e-132 Identities = 231/398 (58%), Positives = 297/398 (74%), Gaps = 3/398 (0%) Query: 1 MEKMTIRDVDLKGKRVIMRVDFNVPVK-DGVVQDDTRIRAALPTIKYALEQGAKVILLSH 59 M+K T+ D+ KGKR++MRVDFNVP+ +G + +D RI ALP+I+ LE G ++IL+SH Sbjct: 1 MQKKTLSDISCKGKRILMRVDFNVPLDLNGTITNDKRIIEALPSIRQVLETGGRLILMSH 60 Query: 60 LGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRF 119 LGRPKG+ +PE SLAPVA+RLSELL +V +G E + L++GEV++LEN RF Sbjct: 61 LGRPKGKVTPELSLAPVARRLSELLDTDVVMANNCIGTEAMQQALALQDGEVMMLENLRF 120 Query: 120 HPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIP-SVAGFLMEKEIKFL 178 HP E KNDPE A+ AS+ +I+VNDAFGTAHRAHAS GI ++P SVAGFL+EKE+++L Sbjct: 121 HPEEEKNDPEFARELASMGEIYVNDAFGTAHRAHASTEGICHYVPISVAGFLIEKELRYL 180 Query: 179 SKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRV 238 NPE+P++ +LGGAK+S KI V+ NL +K D ILIGGAM+FTF KA G +VG+S V Sbjct: 181 GNALANPERPFLAILGGAKISGKIDVLDNLFDKVDTILIGGAMIFTFFKAQGYQVGTSLV 240 Query: 239 EEDKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGP 298 EEDKI+LAK LLEKA K + ++LP D + A E V I D IPE MGLDIGP Sbjct: 241 EEDKIELAKHLLEKAAAKNIRMLLPEDVIAASAFSADAETATVPI-DSIPETMMGLDIGP 299 Query: 299 ETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAA 358 +TI+ + +++ A+T+VWNGPMGVFEID FA GT +A A+A T KGAI+++GGGDSAA Sbjct: 300 KTIDTYSREILKARTIVWNGPMGVFEIDAFATGTIAIAHALADATAKGAISIIGGGDSAA 359 Query: 359 AVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIAD 396 AV K GLE +H+STGGGASLEFLEGKELPGIA++ D Sbjct: 360 AVMKAGLESGITHISTGGGASLEFLEGKELPGIAALND 397 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 652 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 397 Length adjustment: 34 Effective length of query: 620 Effective length of database: 363 Effective search space: 225060 Effective search space used: 225060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory