Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_012537424.1 AFE_RS13045 ROK family protein
Query= curated2:Q9KCZ4 (330 letters) >NCBI__GCF_000021485.1:WP_012537424.1 Length = 315 Score = 131 bits (330), Expect = 2e-35 Identities = 101/331 (30%), Positives = 158/331 (47%), Gaps = 32/331 (9%) Query: 1 MSDRWYVGVDVGGTTIKMAFL-------TTAGEIV--DKWEIPTNKQDGGALITTNIADA 51 M++ +G+DVGGT ++ +T E+ +K + + AL+TT + + Sbjct: 1 MTEGLTIGIDVGGTNLRFGVFRGNELLDSTRSEVDLREKCRQAPDPEGAAALVTTLLTEG 60 Query: 52 LDKRLSGHHKSKSDLIGIGLGAPGFIEMDTGFIYHAVNIGWR-DFPLKDKLEEETKLPVI 110 + L HH + + +G+ PGFI+ D G + + NI F L+ + +LPV+ Sbjct: 61 IAD-LRRHHPN---IARVGIAFPGFID-DDGVLLQSPNIPQLIQFDLQTAVGAACQLPVL 115 Query: 111 VDNDANIAALGEMWKGAGDGAK--NMLLITLGTGVGGGIVANGNILHGVNGMAGEIGHIT 168 V+NDAN A GE W+ + + N+L + LGTGVGGG + G G +G A EIGHI Sbjct: 116 VENDANAAGYGEFWEERQEHPELQNLLYVGLGTGVGGGWIHQGRPWRGDHGSAMEIGHII 175 Query: 169 VIPEGGAPCNCGKTGCLETVASATGIARIATEGVTEHKESQLALDYDKHGVLTAKDVFSA 228 V+P GG C CG GCLE ASA G+ E ++ + A D S Sbjct: 176 VVP-GGRRCGCGNQGCLEQYASARGVQSTYVELTGTAPDAMVIAQ-------MAGDAHS- 226 Query: 229 ADASDAFALSVVDHIAYYLGFAIANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFEAYA 288 +A+ AF ++ YLG +A++ + + IGGG+S A D + Q +A Sbjct: 227 -EAASAFRMA-----GGYLGQVLAHVVKVTDVAVVRIGGGMSAAWDRFAPAMLQRLDADM 280 Query: 289 LPRVADGAEFRIATLGNDAGVIGGGWLVKQQ 319 +P + E + + AG+ G L Q+ Sbjct: 281 IPALRGNVEVKRGNDDDLAGMRGAALLADQE 311 Lambda K H 0.316 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 315 Length adjustment: 28 Effective length of query: 302 Effective length of database: 287 Effective search space: 86674 Effective search space used: 86674 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory