GapMind for catabolism of small carbon sources

 

Protein WP_012590721.1 in Methylocella silvestris BL2

Annotation: NCBI__GCF_000021745.1:WP_012590721.1

Length: 391 amino acids

Source: GCF_000021745.1 in NCBI

Candidate for 31 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-alanine catabolism Pf6N2E2_5403 hi ABC transporter for D-Alanine, permease component 2 (characterized) 50% 100% 350.5 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 46% 334.3
L-asparagine catabolism aapQ med AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 46% 95% 334.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-aspartate catabolism aapQ med AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 46% 95% 334.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-glutamate catabolism aapQ med AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 46% 95% 334.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-histidine catabolism aapQ med AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 46% 95% 334.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-leucine catabolism aapQ med AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 46% 95% 334.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-proline catabolism aapQ med AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 46% 95% 334.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-asparagine catabolism bztB med glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) 40% 96% 262.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-aspartate catabolism bztB med glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) 40% 96% 262.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-glutamate catabolism bztB med glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) 40% 96% 262.3 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-asparagine catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 40% 94% 246.9 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-aspartate catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 40% 94% 246.9 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 32% 95% 118.6 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 32% 95% 118.6 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-histidine catabolism Ac3H11_2554 lo ABC transporter for L-Histidine, permease component 1 (characterized) 30% 96% 95.1 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-glutamate catabolism gltJ lo Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized) 31% 94% 94.7 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-asparagine catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 30% 79% 94 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-aspartate catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 30% 79% 94 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-asparagine catabolism aatQ lo Glutamate/aspartate import permease protein GltJ (characterized) 33% 95% 92 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-aspartate catabolism aatQ lo Glutamate/aspartate import permease protein GltJ (characterized) 33% 95% 92 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-asparagine catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 32% 92% 88.2 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-aspartate catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 32% 92% 88.2 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-glutamate catabolism gltK lo Glutamate/aspartate import permease protein GltK (characterized) 32% 92% 88.2 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-asparagine catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 36% 51% 82 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-aspartate catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 36% 51% 82 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-glutamate catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 36% 51% 82 ABC transporter for D-Alanine, permease component 2 50% 350.5
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-Glucosamine, permease component 1 (characterized) 30% 82% 79 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-lysine catabolism hisQ lo Amino acid ABC transporter, membrane protein (characterized, see rationale) 33% 82% 75.1 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-lysine catabolism hisM lo ABC transporter for L-Lysine, permease component 2 (characterized) 31% 69% 73.6 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-arginine catabolism artM lo Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 31% 55% 68.2 ABC transporter for D-Alanine, permease component 2 50% 350.5
L-histidine catabolism hisM lo Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 31% 55% 68.2 ABC transporter for D-Alanine, permease component 2 50% 350.5

Sequence Analysis Tools

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKLRRHPALELWYDARARAVLLQIAFVAAFVALAALAFIDVRANMEARGIATDLSFLGKV
AGFDINQSLIPYSAASTYGRAFIVGLLNTLLVAAVSLALATVLGFIVGFARLSKNWIVGQ
TAMAYVEAVRNVPLLLQLLFWYNAVLKPLPSPKQSLPLPFGMFLNNRGLFAPAPVFEAGA
FWLVIAAAVSILAAIAMRLTPKRVKFATPPRAFFSGVAAAVLIVLPLAAFVGAGTPIAFI
QPELKGFNFVGGVRLLPEFVALVLGLSLYTAAFIAEIVRAGVEAVPRGQREAAAAIGLNS
AAANRFVIAPQAMRLIVPLLTSQYLNLIKNSSLAVFIGYPDLVQVFAGTVLNQTGAAVQV
IFITMAVYLAISLLASLAMNLYGRRFALVER

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory