Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_012591702.1 MSIL_RS13800 dTDP-glucose 4,6-dehydratase
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_000021745.1:WP_012591702.1 Length = 356 Score = 141 bits (355), Expect = 3e-38 Identities = 111/331 (33%), Positives = 161/331 (48%), Gaps = 29/331 (8%) Query: 2 RALVTGAAGFIGSTLVDRLLADG-HSVVGLDNFA-TGRATNLEHLADNSAHVFVEADIVT 59 R LVTG AGFIGS +V ++ + HSV+ +D G +L+ +A + + F+ ADIV Sbjct: 8 RILVTGGAGFIGSAVVREIIGETPHSVLVVDKLTYAGNLDSLKPVAADPRYDFIRADIVD 67 Query: 60 AD-LHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEA----------A 108 A + ++ Q +P++V HLAA+ V RS+ P NV+GT L +A A Sbjct: 68 APRMQSVFAQFQPDIVMHLAAESHVDRSIDGPGEFIQTNVVGTFTLLQATLGYWRGLPAA 127 Query: 109 RQTGVRKIVHTSSGGSIYGT-PPEYPTPETAPTDPASPYAAGKVAGEIYLNTFRHLYGLD 167 RQT R H S ++G+ PE ET P SPY+A K A + +N +RH YGL Sbjct: 128 RQTSFR--FHHISTDEVFGSLGPEGFFIETTAYCPNSPYSASKAASDHLVNAWRHTYGLP 185 Query: 168 CSHIAPANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVR 227 +N YGP P + I A L GKP V+G G N RD+++V+D A + Sbjct: 186 TVLSNCSNNYGPYHFPEKLIPLTIINA---LEGKPLPVYGAGANIRDWLYVEDHARALLT 242 Query: 228 VSADVGGGLRFNIGTGKETSDRQLHSAVAAAVG--GPDDP--------EFHPPRLGDLKR 277 V+ G + IG E ++ + A+ A V PD F R G R Sbjct: 243 VATQGAVGGSYCIGGHNEKTNLDVVHAICALVDELAPDRAIGPRAGLVSFVSDRPGHDLR 302 Query: 278 SCLDIGLAERVLGWRPQIELADGVRRTVEYF 308 +D LGWRP+ G+R+TV+++ Sbjct: 303 YAIDPSKIAVDLGWRPRETFESGLRQTVQWY 333 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 356 Length adjustment: 28 Effective length of query: 286 Effective length of database: 328 Effective search space: 93808 Effective search space used: 93808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory