Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_012592648.1 MSIL_RS18775 UDP-glucose 4-epimerase GalE
Query= curated2:Q59083 (348 letters) >NCBI__GCF_000021745.1:WP_012592648.1 Length = 329 Score = 399 bits (1026), Expect = e-116 Identities = 198/321 (61%), Positives = 231/321 (71%) Query: 11 VLVTGGAGYIGSHVLHALTDAGIPAVTIDDLSAGRREAIPAAVPLVEGDIGSAELLDRVM 70 VLVTGGAGYIG H+ AL D G V +D+LS G A+P A L+ GD G + L+D++ Sbjct: 3 VLVTGGAGYIGGHMALALLDQGEEVVVLDNLSTGFAWAVPPAAKLIVGDFGDSALVDQIF 62 Query: 71 RDHRVDAVMHFAGSIVVPESVVKPLDYYRNNTANSLTLLGACLRAGIDKVVFSSTAAVYG 130 DHR+DA+ HFA IVVPESV PL YY NNTA + LL ++AG+ + +FSSTAAVYG Sbjct: 63 ADHRIDAIAHFAAKIVVPESVSDPLAYYLNNTAKARNLLECAVKAGVKQFIFSSTAAVYG 122 Query: 131 APESVPIREDAPTVPINPYGASKLMTEQMLRDAGAAHGLRSVILRYFNVAGADPAGRTGQ 190 P P+ E+ PINPYG SKLM E ML D AAH LR V+LRYFNVAGADPAGR GQ Sbjct: 123 EPAENPVFENVALAPINPYGRSKLMVEWMLADVAAAHQLRYVVLRYFNVAGADPAGRLGQ 182 Query: 191 ATPVATHLIKVACQALLGRRPPLAIFGTDYDTPDGTCIRDYIHVSDLADAHVLALLHLRR 250 ++PVATHLIKVA QA LG R L +FGTDY TPDG+C+RDYI V+DL DAH+LAL HLR Sbjct: 183 SSPVATHLIKVAVQAALGHRDGLDVFGTDYPTPDGSCVRDYIQVTDLVDAHLLALAHLRA 242 Query: 251 GGGSLLMNCGYGRGASVREVVRTLEEVSGEQVPATFADRRPGDPPQLVAGADRIREQLGW 310 GGGSL NCGYGRG SV EVV +++VSG RRPGDP LVAGADR+R++LGW Sbjct: 243 GGGSLTCNCGYGRGLSVLEVVEVVKKVSGVDFEVRLKGRRPGDPASLVAGADRVRQELGW 302 Query: 311 VPKHDRLDGIVRSALSWERSL 331 PKHD L IV ALSWER L Sbjct: 303 TPKHDNLAEIVEQALSWERRL 323 Lambda K H 0.319 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 329 Length adjustment: 28 Effective length of query: 320 Effective length of database: 301 Effective search space: 96320 Effective search space used: 96320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_012592648.1 MSIL_RS18775 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.31325.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-135 437.3 0.0 1.7e-135 437.1 0.0 1.0 1 lcl|NCBI__GCF_000021745.1:WP_012592648.1 MSIL_RS18775 UDP-glucose 4-epime Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021745.1:WP_012592648.1 MSIL_RS18775 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.1 0.0 1.7e-135 1.7e-135 2 330 .. 3 325 .. 2 327 .. 0.99 Alignments for each domain: == domain 1 score: 437.1 bits; conditional E-value: 1.7e-135 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeek 70 +LvtGgaGyiG h++ +ll++g evvvlDnls+g+++a++ kl+ gd d++ +++++++++ lcl|NCBI__GCF_000021745.1:WP_012592648.1 3 VLVTGGAGYIGGHMALALLDQGEEVVVLDNLSTGFAWAVPPAA-----KLIVGDFGDSALVDQIFADHR 66 8***************************************999.....6******************** PP TIGR01179 71 idaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEespl 139 ida+ Hfaa+i v+Esv++Pl YY nn+ + +Lle+ +kagvk++iFss+aavYge+ ++p+ E+ +l lcl|NCBI__GCF_000021745.1:WP_012592648.1 67 IDAIAHFAAKIVVPESVSDPLAYYLNNTAKARNLLECAVKAGVKQFIFSSTAAVYGEPAENPVFENVAL 135 ********************************************************************* PP TIGR01179 140 npinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkre 208 +pinpYGrsklmvE++l d++ a ++l++v+LRYFnvaGAd+ g++G++s+ athlik+++++a+g+r+ lcl|NCBI__GCF_000021745.1:WP_012592648.1 136 APINPYGRSKLMVEWMLADVAAA-HQLRYVVLRYFNVAGADPAGRLGQSSPVATHLIKVAVQAALGHRD 203 ********************999.********************************************* PP TIGR01179 209 kleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgk 277 l++fGtdypt+DG cvRDyi v+Dl +aHl al l +gg+s + n+G+g+g sv+ev+e vkkvsg+ lcl|NCBI__GCF_000021745.1:WP_012592648.1 204 GLDVFGTDYPTPDGSCVRDYIQVTDLVDAHLLALAHLRAGGGSLTCNCGYGRGLSVLEVVEVVKKVSGV 272 ********************************************************************* PP TIGR01179 278 dikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklke 330 d++v+l+ rR+GDpaslva a+++++elgw+pk+d+L+ei+++a++We++l++ lcl|NCBI__GCF_000021745.1:WP_012592648.1 273 DFEVRLKGRRPGDPASLVAGADRVRQELGWTPKHDNLAEIVEQALSWERRLHN 325 ************************************************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (329 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.15 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory