Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_012592726.1 MSIL_RS19175 KR domain-containing protein
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000021745.1:WP_012592726.1 Length = 247 Score = 111 bits (278), Expect = 1e-29 Identities = 89/254 (35%), Positives = 129/254 (50%), Gaps = 20/254 (7%) Query: 4 ANKHFIVSGAASGLGAATAQMLVEAGAKVML-VDLNAQAVEAKAREL---GDNARFAVAD 59 +NK IV+GA+ G+GAA A L G V++ A EA RE+ G A AD Sbjct: 6 SNKIAIVTGASRGIGAAVATRLAADGFTVVVNYSSEAAPAEALTREIEARGGRALSVRAD 65 Query: 60 ISDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSF 119 +SD QA +S DA +AFG + LVN AGI+ + ASF + +NVNL G+F Sbjct: 66 VSDAQAVRSTFDATEAAFGGVDVLVNNAGIMALAAIADTDD----ASFERQMNVNLKGTF 121 Query: 120 NLLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAAREL 179 N LR A+ + +G G IIN +S Q YAA+K A+ ++T A+EL Sbjct: 122 NTLREASRRLRDG--------GRIINLSSSVVGLLQPTYGVYAATKAAVEAMTSVLAKEL 173 Query: 180 ARFGIRVMTIAPGIFETPM-MAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHII--EN 236 I V +APG T + + G +E+ LA P RLG+P + AA + + Sbjct: 174 RGRSITVNAVAPGPTATDLFLNGKPEELVERLAKLAPL-ERLGQPADIAAAVSFLAGPDG 232 Query: 237 SMLNGEVIRLDGAL 250 + +NG+ +R +G + Sbjct: 233 AWINGQTLRANGGI 246 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 247 Length adjustment: 24 Effective length of query: 231 Effective length of database: 223 Effective search space: 51513 Effective search space used: 51513 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory