Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate WP_012673472.1 SULAZ_RS00275 3-oxoacyl-[acyl-carrier-protein] reductase
Query= SwissProt::Q9HK58 (254 letters) >NCBI__GCF_000021545.1:WP_012673472.1 Length = 246 Score = 159 bits (402), Expect = 5e-44 Identities = 103/251 (41%), Positives = 148/251 (58%), Gaps = 8/251 (3%) Query: 1 MLDFKGKNAVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVL--ETASKYGVKA 58 MLDFKGKN ++TG +RGIG+AIAL AK GAN++I+ + A EVL +++GVKA Sbjct: 1 MLDFKGKNVLVTGSTRGIGKAIALSFAKHGANVIIT--GREKSAAEVLAKNIENEFGVKA 58 Query: 59 HKVKVDQSDPYESIRFAEKAIETFGKVHILVDNAGICPFEDFFRISVDLFEKVWKVNVES 118 + +D S ES F E + GK+ +LV+NAGI F R+ + ++ V N+ Sbjct: 59 FGINLDLSGDIES-PFKEIVDWSGGKIDVLVNNAGITKDTLFIRMKQEDWDSVINTNLTG 117 Query: 119 HYFITQRIAKNMIENKINGRILLISSISAHVGGEFQTHYTTTKSALNGFMHSIAIVLGKY 178 + ITQ +AK MI+ + GRI+ ISSI +G Q +Y TTK+ L GF S+A L Sbjct: 118 TFKITQSVAKLMIKQRY-GRIINISSIIGFIGNVGQVNYATTKAGLIGFTKSLAKELASR 176 Query: 179 GILVNSLEPGTILTDINKEDLSNQEKRAYMERRTVVGRLGLPEDMVAPALFLLSDDNTYV 238 I VN++ PG I TD+ +L +Y+ ++ +GR G PED+ LFL SD +Y+ Sbjct: 177 NITVNAVAPGFIETDMT-ANLPADIVESYL-KQIPLGRFGKPEDVANVVLFLASDMASYI 234 Query: 239 TGTELLADGGM 249 TG + +GGM Sbjct: 235 TGETIHVNGGM 245 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 246 Length adjustment: 24 Effective length of query: 230 Effective length of database: 222 Effective search space: 51060 Effective search space used: 51060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory