Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate WP_012673497.1 SULAZ_RS00885 KR domain-containing protein
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >NCBI__GCF_000021545.1:WP_012673497.1 Length = 259 Score = 132 bits (331), Expect = 9e-36 Identities = 90/261 (34%), Positives = 133/261 (50%), Gaps = 15/261 (5%) Query: 1 MLLKDKVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVAEIEAL 60 M+L++K+ +TG SRGIGRAIA+ A+ G DV +NY Y + EVV EIE++ Sbjct: 1 MVLEEKLAFITGASRGIGRAIALKLASMGCDVIVNY-------YKSKEKAEEVVKEIESM 53 Query: 61 GRRVIAIEGNVAARETGQQLVRHTVEAFGKVDVLASNAG------ICPFHAFLDMPPEVL 114 GR+ AI+G+ +E ++ E FG +D+ SNA + F FL + + Sbjct: 54 GRKGYAIQGDFGVKEDIDRVFDEITEKFGYLDIFVSNAVASGREVVGGFAPFLRLKEKGT 113 Query: 115 ESTVAVNLNGAFYVTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLM 174 + G + +Q A + M +G G I+A SS + KA + +L+ Sbjct: 114 LRIYNITTFGFIWSSQRAVKLM--EGREGKIIAISSTGTRDYMPNYAIHGSAKAALETLV 171 Query: 175 QSCAVALGPYGIRCNSVMPGTIATDLNAQDLADEAKKAYFEKRIPLGRLGRPEDVADCVT 234 + AV +GP GI N V G I T+ E K K PLGR+G+PED+A V Sbjct: 172 RYLAVEVGPMGINVNCVSGGPIDTEAIQLFPNYEEVKEGTIKLTPLGRMGQPEDIAGVVG 231 Query: 235 FLASDRARYVTGAALLVDGGL 255 FL + AR++ G ++VDGGL Sbjct: 232 FLCTPDARWIQGQTIIVDGGL 252 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 259 Length adjustment: 24 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory