Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_012673695.1 SULAZ_RS04435 UDP-glucose 4-epimerase GalE
Query= SwissProt::Q7WTB1 (330 letters) >NCBI__GCF_000021545.1:WP_012673695.1 Length = 341 Score = 273 bits (697), Expect = 6e-78 Identities = 144/335 (42%), Positives = 205/335 (61%), Gaps = 15/335 (4%) Query: 1 MKVLVIGGAGYIGSHAVRELVKEGN-DVLVLDALYTGHRKAV------------DPKAKF 47 M +L+ GGAGYIGSH V++L+ E N ++ ++D L TG K + + F Sbjct: 1 MNILITGGAGYIGSHVVKQLLDETNHNITIIDNLSTGSIKTIKTLKEIAKINNKEENLDF 60 Query: 48 YQGDIEDTFLVSKILRDEKIDAVMHFAAYSLVPESVKKPLKYYDNNVTGMISLLQAMNDA 107 + D+ + L+ I++ +K DAV+HFAA +VPESVK P+KYY NN +L++ D Sbjct: 61 IEADLSNFPLIEGIIKAKKFDAVIHFAASIIVPESVKNPIKYYMNNTVNTTNLIKLCLDN 120 Query: 108 NVKYLVFSSSAATYGIPKKLPITEDTPLNPINPYGETKMMMEKIMAWADKA-DGIKYTAL 166 NV +FSS+AA YG P ++P+ E TP PINPYG +K+M E ++ A KY L Sbjct: 121 NVNKFIFSSTAAVYGQPYEIPVKETTPTKPINPYGMSKLMSETVLKDCGLAYPDFKYIIL 180 Query: 167 RYFNVAGASSDGSIGEDHAPETHLIPNILKSAISGDGKFTIFGDDYDTKDGTNVRDYVQV 226 RYFNVAGA IG+ THLI ++A+ K +FG DY TKDGT +RDY+ V Sbjct: 181 RYFNVAGADIKIRIGQRFPNATHLIKVAAETAVGKREKMYVFGTDYPTKDGTCIRDYIHV 240 Query: 227 EDLIDAHILALKHMMKTNKSDVFNLGTAHGYSNLEILESAKKVTGIDIPYTMGPRRGGDP 286 +DL DAHI AL++ + N SDVFN G +GYS LE++ + KKV+G+D RR GDP Sbjct: 241 DDLADAHIKALEY-LTDNDSDVFNCGYGYGYSVLEVINTMKKVSGVDFKVEFTGRREGDP 299 Query: 287 DSLVADSTKARTVLGWKPKHENVDDVIATAWKWHK 321 L+AD++K + + W+PK+ N++ + TA +W K Sbjct: 300 AILIADNSKIKNKMKWQPKYNNLELICKTALEWEK 334 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 341 Length adjustment: 28 Effective length of query: 302 Effective length of database: 313 Effective search space: 94526 Effective search space used: 94526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_012673695.1 SULAZ_RS04435 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.29964.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-148 479.8 0.2 1.9e-148 479.6 0.2 1.0 1 lcl|NCBI__GCF_000021545.1:WP_012673695.1 SULAZ_RS04435 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021545.1:WP_012673695.1 SULAZ_RS04435 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 479.6 0.2 1.9e-148 1.9e-148 1 329 [. 2 337 .. 2 340 .. 0.97 Alignments for each domain: == domain 1 score: 479.6 bits; conditional E-value: 1.9e-148 TIGR01179 1 kiLvtGgaGyiGshvvrqllek.gkevvvlDnlskgskealkalekit.......evklvegdladkek 61 +iL+tGgaGyiGshvv+qll++ ++++ ++Dnls+gs +++k+l++i ++ ++e+dl++ lcl|NCBI__GCF_000021545.1:WP_012673695.1 2 NILITGGAGYIGSHVVKQLLDEtNHNITIIDNLSTGSIKTIKTLKEIAkinnkeeNLDFIEADLSNFPL 70 59****************98661577****************9999877777777899*********** PP TIGR01179 62 leavleeekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesek 130 +e +++++k+daviHfaa+i v+Esvk+P+kYY+nn+vnt++L++++ + +v+k+iFss+aavYg++ + lcl|NCBI__GCF_000021545.1:WP_012673695.1 71 IEGIIKAKKFDAVIHFAASIIVPESVKNPIKYYMNNTVNTTNLIKLCLDNNVNKFIFSSTAAVYGQPYE 139 ********************************************************************* PP TIGR01179 131 vpisEesplnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklv 199 +p++E++p++pinpYG sklm+E +lkd+ a +++k++iLRYFnvaGAd + +iG++ +nathlik++ lcl|NCBI__GCF_000021545.1:WP_012673695.1 140 IPVKETTPTKPINPYGMSKLMSETVLKDCGLAYPDFKYIILRYFNVAGADIKIRIGQRFPNATHLIKVA 208 ********************************************************************* PP TIGR01179 200 aevavgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevi 268 ae+avgkrek+ +fGtdyptkDGtc+RDyiHv+Dla+aH++ale+l++ ++s+v+n+G+g g+sv+evi lcl|NCBI__GCF_000021545.1:WP_012673695.1 209 AETAVGKREKMYVFGTDYPTKDGTCIRDYIHVDDLADAHIKALEYLTD-NDSDVFNCGYGYGYSVLEVI 276 **********************************************96.9******************* PP TIGR01179 269 eavkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklk 329 +++kkvsg+d+kve++ rR+GDpa l+ad+skik+++ w+pky++Le i+k+a++Wekkl lcl|NCBI__GCF_000021545.1:WP_012673695.1 277 NTMKKVSGVDFKVEFTGRREGDPAILIADNSKIKNKMKWQPKYNNLELICKTALEWEKKLL 337 *********************************************************9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (341 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.69 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory