Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_012674334.1 SULAZ_RS01730 polysaccharide biosynthesis protein
Query= curated2:A8GWP0 (341 letters) >NCBI__GCF_000021545.1:WP_012674334.1 Length = 626 Score = 149 bits (376), Expect = 2e-40 Identities = 100/282 (35%), Positives = 158/282 (56%), Gaps = 22/282 (7%) Query: 5 KTLLITGGTGSFGNAVLSRFLKNDIIKDIKEIRIFSRDEKKQEDMRIALNNPKIKFY--- 61 K + I+G GS G+ ++ + + + I F DE + ++ + + + K K Y Sbjct: 295 KKIFISGAGGSIGSEIVRQVIDFNPCMIIA----FEIDETELYNLTLEVLD-KCKGYGIE 349 Query: 62 ----IGDVRNYNSIDDAMKDV--DYVFHAAALKQVPTCEFYPMEAINTNILGAENVLRAA 115 +GD+RN + +D+ K VFHAAA K VP E++P EA+ TN+ G N+ + Sbjct: 350 FIPIVGDIRNKDKLDNIFKKYAPKIVFHAAAYKHVPLMEYFPEEAVKTNVFGTYNLADVS 409 Query: 116 TINKVAKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMNVRDKTVFCVTRYGNVMASR 175 KV K + +STDKAV P + MG +K L E + + ++N+ T F R+GNV+ SR Sbjct: 410 VKYKVEKFVNISTDKAVNPTSIMGATKRLAEIICNSFNQVNI---TKFISVRFGNVLGSR 466 Query: 176 GSVIPLFINQIKQNKDLTITEPSMTRFLMSLVDSVDLVLYAFEYGHQGDIFV--QKSPAS 233 GSVIP+F+ QIK+ +T+T P M R+ M++ ++V LVL A G G+IFV P Sbjct: 467 GSVIPIFLEQIKKGGPVTVTHPEMQRYFMTIPEAVLLVLQAAAMGEGGEIFVLDMGEPIK 526 Query: 234 TIEVLAK--ALQGIFNSKN-KIRFIGTRHGEKHYESLVSSEE 272 +++ + LQ + K+ +I F G R GEK +E L+++EE Sbjct: 527 IVKLAEELIRLQNLEPYKDIEIVFSGLRPGEKLFEELLTAEE 568 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 525 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 626 Length adjustment: 33 Effective length of query: 308 Effective length of database: 593 Effective search space: 182644 Effective search space used: 182644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory