Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_012675249.1 PERMA_RS04770 phosphoglucomutase
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_000021565.1:WP_012675249.1 Length = 459 Score = 205 bits (522), Expect = 2e-57 Identities = 153/455 (33%), Positives = 219/455 (48%), Gaps = 25/455 (5%) Query: 5 FGTFGVRGIANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEALISG 64 FGT G R + ++ T + K+ A LK + K+ VV+G D R E + Sbjct: 5 FGTDGWRAVIADQFTFDAVAKVAQAHADHLKEKNGKR--VVIGYDPRFMSEDFAYIVAEV 62 Query: 65 LLSVGCDVI-DVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLKKE 123 L S +VI + TPA+ ATK NAD G +ITASHN YNG K+ G E Sbjct: 63 LSSNDFEVILSSSVCTTPALALATKELNADEGVMITASHNTYRYNGYKIKGSYGGPATPE 122 Query: 124 REAIVEELFFKEDFDRAK--WYEIGEVRREDIIKPYIEAIKSKVDVEAIKKRKPFVVVDT 181 +EE + K W EI D+ YIE +K + E +++ VV D Sbjct: 123 IIKDIEEKIGLSQVKKGKTRWEEI------DLNSLYIERLKRYIMPELFRQKMEKVVHDP 176 Query: 182 SNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGADFGVA 241 +G+ L LL + V +N D YF +PEP ++NL V A A G+A Sbjct: 177 MHGSAMGLLSQLLEDTFIDVSQINHYRDPYFGGHHPEPIDKNLSLLKGKVVAEEALVGIA 236 Query: 242 QDGDADRAVFIDENGRFIQGDKTFALVADAVLK-EKGGGLLVTTVATSNLLDDIAKKHGA 300 DGD DR +DE G F+ +AL+ L+ +K G + TV+TS L+D I +K Sbjct: 237 NDGDGDRVGIVDEAGEFVSTQIGYALLLLHTLRNKKVEGAVAKTVSTSYLVDRICEKENR 296 Query: 301 KVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAKSGKKF 360 K+ +T VG +A + GGEE+GG F H+ RDG ++ ++E+ GK Sbjct: 297 KLYKTPVGFKYIADIFLKEKIAFGGEESGGYGFGFHIPERDGLLSGLMIIEMILLHGKPL 356 Query: 361 SELIDEL-----PKYYQIKTKRHVEGDRHAIV------NKVAEMARERGYTVDTTDGAKI 409 S++I++L YY+ + V GD I+ + E+A + D TDG K Sbjct: 357 SKIIEDLFSEFGTAYYR-REDLKVNGDEGRILVERLKKEPLKELAGLKIKETDLTDGVKF 415 Query: 410 IFE-DGWVLVRASGTEPIIRIFSEAKSKEKAQEYL 443 IFE DGWVL RASGTEP++RI+ E + + L Sbjct: 416 IFENDGWVLFRASGTEPVLRIYVEMPERSQVDRIL 450 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 459 Length adjustment: 33 Effective length of query: 422 Effective length of database: 426 Effective search space: 179772 Effective search space used: 179772 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory