Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_012676854.1 PERMA_RS05205 triose-phosphate isomerase
Query= BRENDA::Q10657 (247 letters) >NCBI__GCF_000021565.1:WP_012676854.1 Length = 256 Score = 219 bits (557), Expect = 5e-62 Identities = 127/252 (50%), Positives = 168/252 (66%), Gaps = 15/252 (5%) Query: 4 KFFVGGNWKMNGDYA-SVDGIVTFLNASADNSSVDVVVAPPAPYLAYAKSKLKAG----- 57 ++ V NWKMN +++ + FL + D SVD+++APP L+ A +L A Sbjct: 2 RYLVAANWKMNKTVGETLEYLDRFLPSVKDLLSVDIMIAPPFTALSSASIRLDAAKKEGE 61 Query: 58 --VLVAAQNCYKVPKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHA 115 V + AQN Y V KGAFTGEISP M+ +L +E+VILGHSERRH+FGE D LI +K + A Sbjct: 62 YNVKLGAQNMYYVEKGAFTGEISPVMLNELDVEYVILGHSERRHIFGEKDDLINKKVITA 121 Query: 116 LEAGIKVVFCIGEKLEEREAGHTKDVNFRQLQ---AIVDKGVSWENIVIAYEPVWAIGTG 172 +E GI+ + C+GE LEERE G T V RQ++ A V+K +++ I IAYEPVWAIGTG Sbjct: 122 VETGIRPILCVGETLEEREQGKTLSVVERQIRNGLAGVEKDMAF--IDIAYEPVWAIGTG 179 Query: 173 KTASGEQAQEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLVGG 232 A+ EQAQEVH +IR+ + E +S TRI+YGGSV NA +L K+P++DGFLVG Sbjct: 180 VNATPEQAQEVHRFIRSLINE-ISKGNDSNTRILYGGSVNEKNARDLIKEPNVDGFLVGT 238 Query: 233 ASLKPD-FVKII 243 ASL P+ F KII Sbjct: 239 ASLDPERFYKII 250 Lambda K H 0.317 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 256 Length adjustment: 24 Effective length of query: 223 Effective length of database: 232 Effective search space: 51736 Effective search space used: 51736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_012676854.1 PERMA_RS05205 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.6799.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-61 194.3 0.0 1.6e-61 194.0 0.0 1.1 1 lcl|NCBI__GCF_000021565.1:WP_012676854.1 PERMA_RS05205 triose-phosphate i Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021565.1:WP_012676854.1 PERMA_RS05205 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 194.0 0.0 1.6e-61 1.6e-61 1 228 [] 4 244 .. 4 244 .. 0.91 Alignments for each domain: == domain 1 score: 194.0 bits; conditional E-value: 1.6e-61 TIGR00419 1 lviinfKlnesvgkvelevaklaeevaseagvevavappf.......vdldvvkdeveseiqvaAqnvd 62 lv n+K+n +vg+ + + + v + v + +appf + ld +k+e e +++++Aqn+ lcl|NCBI__GCF_000021565.1:WP_012676854.1 4 LVAANWKMNKTVGETLEYLDRFLPSVKDLLSVDIMIAPPFtalssasIRLDAAKKEGEYNVKLGAQNMY 72 6999***********************************933333223456778888899********* PP TIGR00419 63 avksGaftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleerea 131 v++GaftGeis ml++l +++v++gHsErR ++ e d+li+kkv ++ e g+++++Cvgetleere lcl|NCBI__GCF_000021565.1:WP_012676854.1 73 YVEKGAFTGEISPVMLNELDVEYVILGHSERRHIFGEKDDLINKKVITAVETGIRPILCVGETLEEREQ 141 ********************************************************************* PP TIGR00419 132 artinnvatt..aaaaAlepdv....vAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvr 194 ++t+ +v ++ ++ a e+d+ +A+EPv++iGtG+ +++ +a++v+ ++r ++++sk ++r lcl|NCBI__GCF_000021565.1:WP_012676854.1 142 GKTLSVVERQirNGLAGVEKDMafidIAYEPVWAIGTGVNATPEQAQEVHRFIRSLINEISKGNDSNTR 210 *******99832344556655444558****************************************** PP TIGR00419 195 vlyGasvtaaedaelaaqldvdGvLlasavlkae 228 +lyG+sv+++++ +l+ +++vdG+L+++a+l +e lcl|NCBI__GCF_000021565.1:WP_012676854.1 211 ILYGGSVNEKNARDLIKEPNVDGFLVGTASLDPE 244 ******************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (256 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.38 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory