Align acetohydroxy-acid synthase small subunit (EC 2.2.1.6) (characterized)
to candidate WP_012708543.1 NGR_RS21280 acetolactate synthase small subunit
Query= metacyc::MONOMER-11901 (169 letters) >NCBI__GCF_000018545.1:WP_012708543.1 Length = 190 Score = 128 bits (321), Expect = 6e-35 Identities = 68/170 (40%), Positives = 108/170 (63%), Gaps = 9/170 (5%) Query: 1 MKNTHIISVLVLNKPGVLQRISGLFTRRWYNISSITGGSTD-STDISRMTIVVKGDDKVV 59 + TH +SVLV N+PGVL R+ GLF+ R YNI S+T T+ +SR+TIV +G V+ Sbjct: 20 LAETHTLSVLVDNEPGVLARVIGLFSGRGYNIESLTVSETEHEAHLSRITIVTRGTPHVL 79 Query: 60 EQVVKQLNKLIEVIKVIDLD-------EEECVERELCLIKIYAPTESSKSQVIQYANIFR 112 EQ+ QL +L+ V +V+DL + VEREL L+K++ E + + ++ A+ FR Sbjct: 80 EQIKNQLERLVPVHRVVDLTVRAAGLGHDRPVERELALVKVHGSGEH-RVEALRLADAFR 138 Query: 113 GNIVDLSQESLTVQITGDKTKISAFIKLVKPMGIKEISRTGLTALMRGPK 162 +++D + + +ITG +KI FI ++KP+G+ E+ RTG+ A+ RGP+ Sbjct: 139 ASVIDANIDHFVFEITGKPSKIEQFIAIMKPLGLIEVCRTGIAAMNRGPQ 188 Lambda K H 0.317 0.134 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 75 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 169 Length of database: 190 Length adjustment: 19 Effective length of query: 150 Effective length of database: 171 Effective search space: 25650 Effective search space used: 25650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
Align candidate WP_012708543.1 NGR_RS21280 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.13108.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.13108.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.