Align 3-ketoacyl-CoA thiolase; EC 2.3.1.16; Acetyl-CoA acyltransferase; Beta-ketothiolase; Fatty acid oxidation complex subunit beta (uncharacterized)
to candidate WP_012755967.1 RLEG_RS01225 acetyl-CoA acetyltransferase
Query= curated2:B7H1I1 (390 letters) >NCBI__GCF_000023185.1:WP_012755967.1 Length = 402 Score = 241 bits (616), Expect = 2e-68 Identities = 154/405 (38%), Positives = 222/405 (54%), Gaps = 27/405 (6%) Query: 8 DVVIVDGVRSAMGKSK-NGMFRNVRADSLSAELVRALVARNQFDVNEVEDLIWGCVNQTL 66 +V I D VR+ G+ K +G V + L+A+ + A+ RN D V+D+I GCV+ + Sbjct: 3 EVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGLDTATVDDIIMGCVDPVM 62 Query: 67 EQGMNIGRNIGLLAGLPKTVAGQTVNRLCGSSMQAIHTAAAQIATNQGDIFIIGGVEHMG 126 + G I + AG G ++R C S + A++ A +IA DI I GGVE M Sbjct: 63 DAGAVIPKAAAFEAGYSTKAPGMQISRFCASGLDAVNFGAGKIAQGADDIVIAGGVESMS 122 Query: 127 HVGM-MHGIDLNPEASKHYAKASNMMGLTAEMLGRMNGITREEQDAFGVESHRRAWAATQ 185 VG+ M G + S ++ G++A+++ G +R + DA+ VES +RA A + Sbjct: 123 RVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSRTDVDAYAVESQKRAAHAWE 182 Query: 186 EGRFKNEIIGVEGHDANGFKILCDIDEVIRPDANLEAFKALKPVFDPKG--GSVTAA--- 240 +G F +I V+ D NG IL DE +RP +++A +L P F G G A Sbjct: 183 KGWFDKSVIPVK--DQNGLTILAK-DEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQ 239 Query: 241 ---------------TSSALSDGASAMLLMSAERAQALGLKPRAVIRSMAVAGCDAAIMG 285 SS + DGAS +LL S Q++G KPRA I++ A G D A+M Sbjct: 240 AHPEIERINYVHHAGNSSGIVDGASVVLLGSKAGGQSMGKKPRARIKAFANIGSDPALML 299 Query: 286 YGPVPATQKALKRAGLSIADIQTVELNEAFAAQGLSVLKGLGLYDKQDIVNLNGGAIALG 345 GPV T+K LKR+G+S++DI ELNEAFAA L ++ + D +N+NGGAIA+G Sbjct: 300 TGPVDVTEKLLKRSGMSLSDIDLFELNEAFAAVVLRYMQAFDI--DHDRINVNGGAIAMG 357 Query: 346 HPLGCSGARITTTLLNVMEQQDTQIGLATMCIGLGQGIATVIERV 390 HPLG +GA I T+L+ +E++D L T+CIG G G ATVIERV Sbjct: 358 HPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVIERV 402 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 402 Length adjustment: 31 Effective length of query: 359 Effective length of database: 371 Effective search space: 133189 Effective search space used: 133189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012755967.1 RLEG_RS01225 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.11533.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-124 401.6 0.3 1.9e-124 401.4 0.3 1.0 1 lcl|NCBI__GCF_000023185.1:WP_012755967.1 RLEG_RS01225 acetyl-CoA acetyltr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000023185.1:WP_012755967.1 RLEG_RS01225 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 401.4 0.3 1.9e-124 1.9e-124 1 385 [] 6 400 .. 6 400 .. 0.95 Alignments for each domain: == domain 1 score: 401.4 bits; conditional E-value: 1.9e-124 TIGR01930 1 ivdavRtpig..klggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaal 66 i+d vRtp g k g+l+e++++ L+a++++++ +r+gld + +d++i+G+v + + a i + aa+ lcl|NCBI__GCF_000023185.1:WP_012755967.1 6 IYDHVRTPRGrgKKDGALHEVPSVRLAAKTLEAIRDRNGLDTATVDDIIMGCVDPVMDAgAVIPKAAAF 74 7899*******988********************************************99********* PP TIGR01930 67 aaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkak 135 +ag +++ p+++++r+CaSgl+Av+ +a ki+ G+ d+v+aGGvEsmSrv ++++ ++ +++ lcl|NCBI__GCF_000023185.1:WP_012755967.1 75 EAGYSTKAPGMQISRFCASGLDAVNFGAGKIAQGADDIVIAGGVESMSRVGLGMSGG--AWFMDPS--V 139 **************************************************9999987..7888882..2 PP TIGR01930 136 ledqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgkkkv 204 + + +++g++A+ +a+kyg+sR+++D+ya++S+++aa+A+e+g f+++++pv+ ++ ++ lcl|NCBI__GCF_000023185.1:WP_012755967.1 140 NF-------PAYFMPQGVSADLIATKYGFSRTDVDAYAVESQKRAAHAWEKGWFDKSVIPVKDQNGLTI 201 22.......35689************************************************998899* PP TIGR01930 205 vskDegirpnttlekLakLkpafkekkgs....................tvtAgNssqlnDGAaalllm 253 ++kDe++rp+t +++La+L+p f+ g+ +++AgNss++ DGA+++ll lcl|NCBI__GCF_000023185.1:WP_012755967.1 202 LAKDEHMRPGTDMQALASLNPSFQM-PGEmggfeavgiqahpeierinyVHHAGNSSGIVDGASVVLLG 269 ***********************98.344455667777777888888889******************* PP TIGR01930 254 seevakelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavek 322 s++ +++g +p ari ++a++g+dp+ m++gpv +ek+Lk+ g+s+sdidl+E+nEAFAa+vl ++ lcl|NCBI__GCF_000023185.1:WP_012755967.1 270 SKAGGQSMGKKPRARIKAFANIGSDPALMLTGPVDVTEKLLKRSGMSLSDIDLFELNEAFAAVVLRYMQ 338 ********************************************************************* PP TIGR01930 323 elgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 +++ +d++++NvnGGAiA+GHPlGa+Ga+i+ t+l+eL++r+ + +l+tlC+g G+G+A+++e lcl|NCBI__GCF_000023185.1:WP_012755967.1 339 AFD-IDHDRINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVIE 400 ***.88*******************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (402 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.08 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory