Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_012756017.1 RLEG_RS01520 3-oxoacyl-ACP reductase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000023185.1:WP_012756017.1 Length = 262 Score = 115 bits (288), Expect = 9e-31 Identities = 82/239 (34%), Positives = 118/239 (49%), Gaps = 21/239 (8%) Query: 3 IANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADISD 62 ++ K +V+G ASG+G A Q GA+V++ DL+ + A +G + A D++ Sbjct: 9 LSGKVALVTGGASGIGKAVCQRFAAEGARVVVADLDGERCARVAEAIGPDVWGAALDVTR 68 Query: 63 EQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFNLL 122 + + + AV +S G + LVN AGI E +L A+V VN+ G + Sbjct: 69 QDSIEEAVRFTISTAGQIDILVNAAGIYDVESILEISRERT----ARVFQVNIEGLIFMT 124 Query: 123 RLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELARF 182 + A M E GE G IIN +S A G+ AY ASK A+ S+T A EL R+ Sbjct: 125 QAVARHMVE-----RGEGGRIINFSSQAGRRGEGPAVAYCASKAAVISITQSCALELIRY 179 Query: 183 GIRVMTIAPGIFETPMMAGMS-----------DEVRASLAAGVPFPPRLGRPQEYAALA 230 GI V IAPG+ +TPM + +V+ +AA VP R G PQE AA+A Sbjct: 180 GINVNAIAPGVVDTPMWDVVDAKLGSREGLRPGDVKRRVAAAVP-AGRFGAPQEQAAMA 237 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory