Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_012756017.1 RLEG_RS01520 3-oxoacyl-ACP reductase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2119 (272 letters) >NCBI__GCF_000023185.1:WP_012756017.1 Length = 262 Score = 140 bits (353), Expect = 3e-38 Identities = 89/254 (35%), Positives = 134/254 (52%), Gaps = 9/254 (3%) Query: 18 RLKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQGEKVEKVAAHWRDQGADVVAIKA 77 RL KV L+TG A GIG+A+ FA++ AR++++D+ GE+ +VA G DV Sbjct: 8 RLSGKVALVTGGASGIGKAVCQRFAAEGARVVVADLDGERCARVA---EAIGPDVWGAAL 64 Query: 78 DVSRQQDLHAMARLAIDLHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGC 137 DV+RQ + R I G+ID+LVN AG+ LE++ E R F ++++G + Sbjct: 65 DVTRQDSIEEAVRFTISTAGQIDILVNAAGIYDVESILEISRERTARVFQVNIEGLIFMT 124 Query: 138 KAVLPQMIEQGIGS-IINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVN 196 +AV M+E+G G IIN +S Y +K ++ +T++ +E G+ VN Sbjct: 125 QAVARHMVERGEGGRIINFSSQAGRRGEGPAVAYCASKAAVISITQSCALELIRYGINVN 184 Query: 197 AIAPGYIETQL--NVDYWNGFAD---PHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDE 251 AIAPG ++T + VD G + P ++R P R G P E A A FLA + Sbjct: 185 AIAPGVVDTPMWDVVDAKLGSREGLRPGDVKRRVAAAVPAGRFGAPQEQAAMAAFLAGPD 244 Query: 252 APFINASCITIDGG 265 A +I A C +DGG Sbjct: 245 AAYIVAQCYNVDGG 258 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 262 Length adjustment: 25 Effective length of query: 247 Effective length of database: 237 Effective search space: 58539 Effective search space used: 58539 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory